KEGG   Lates calcarifer (barramundi perch): 108883003
Entry
108883003         CDS       T04895                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00230  Purine metabolism
lcf00240  Pyrimidine metabolism
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108883003 (dck)
   00240 Pyrimidine metabolism
    108883003 (dck)
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     108883003 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_17 AAA_28 Thymidylate_kin
Other DBs
NCBI-GeneID: 108883003
NCBI-ProteinID: XP_018531392
UniProt: A0A4W6F8M7
Position
Unknown
AA seq 271 aa
MSVTPKRRCPVSIDDSMNDSMNDSMEKRIRRISVEGNIAAGKSTFVRLLEQESADWEVVP
EPIARWCNVQTNGSEFEELTTSQRSGGNVLQMMYEKPDRWAYTFQSYACISRVRAQIRSA
NGKLQEAEDPVQFFERSIYSDRYIFAANLYESGCLNETEWSVYQDWHGWLHNQFGKHIEL
DGIIYLRASPEKCLERLHLRGREEEQDIPLEYLEKLHFKHESWLQHKKMMMEFDYLSDVP
VLTIDVNEEFKGNNTKSADMIEKVKEFLSTL
NT seq 816 nt   +upstreamnt  +downstreamnt
atgtctgtcactccgaagagacgctgccccgtctccattgatgactcaatgaacgactcc
atgaacgactcaatggagaaaaggataaggcgaatttcagtcgaaggaaatatcgcggcg
ggcaaatccacatttgtccgccttttggagcaggagagcgcggactgggaggtggtaccg
gagccaatcgccaggtggtgcaatgtccaaacaaacggcagtgagtttgaggagctgacc
acgtctcagagaagtggagggaatgtattgcagatgatgtatgagaaaccggacaggtgg
gcctacactttccagagctacgcctgcatcagcagggtacgcgcccagatcaggtcagcc
aatgggaagctgcaagaagctgaggaccctgtgcagttctttgagcggtccatctacagt
gacaggtacatctttgcagccaacctgtatgagagcggctgcctgaatgagactgaatgg
tctgtgtaccaggactggcacggctggctgcacaaccagtttggcaagcacatcgagctg
gatggtatcatctacctcagagcttcccctgagaaatgcctagagagattgcacctgaga
ggcagagaagaagagcaagacatccccctggagtatctggagaagctccactttaaacat
gagagctggctgcagcacaagaaaatgatgatggagtttgactatctcagtgatgtgcca
gtcttgaccatagatgtgaatgaagaatttaagggaaataataccaagagcgcagacatg
attgagaaggtgaaagagttcttgagcacattgtga

DBGET integrated database retrieval system