KEGG   Lates calcarifer (barramundi perch): 108883337Help
Entry
108883337         CDS       T04895                                 

Gene name
rock1
Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04270  Vascular smooth muscle contraction
lcf04350  TGF-beta signaling pathway
lcf04510  Focal adhesion
lcf04530  Tight junction
lcf04810  Regulation of actin cytoskeleton
lcf05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108883337 (rock1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108883337 (rock1)
   04530 Tight junction
    108883337 (rock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108883337 (rock1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108883337 (rock1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108883337 (rock1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcf01001]
    108883337 (rock1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lcf03036]
    108883337 (rock1)
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108883337 (rock1)
Protein kinases [BR:lcf01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   108883337 (rock1)
Chromosome and associated proteins [BR:lcf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    108883337 (rock1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH HR1 C1_1 Filament Pkinase_C Cortex-I_coil APH
Motif
Other DBs
NCBI-GeneID: 108883337
NCBI-ProteinID: XP_018531837
Position
Unknown
AA seq 1380 aa AA seqDB search
MSAGEGIEARFEKIDAMLKDPKSEINTDCLLDGLDALVYDLDFPALRKNKSIDNFLNRYK
ETISKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKATSKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFADSAWVVQLFFAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDGIHSMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKDGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFP
EDSDISNDAKNLICAFLTDREVRLGRNGVDEIKRHPFFKNDQWTWENIRETAAPVVPELS
SDIDTSNFDDIEEDRGEEETFPIPKAFVGNQLPFVGFTYYSNQHLLRSSTATKTSDKRSS
STKEDKSHLENLQKRIYHLEEQLHSEMQLKDELEQKCRTSNTKIDKIMKELDEEANLRKS
AEASMSLLEKDKIMLQHRFTEYQRKADQEAEKRRNLENEVSTLKEQLEDMRKISQNSQAS
NDKIAQLQNQLEEANDLLRAESDTAARLRKSHTEMAKSMSQLESLNRELQERSRGADGEK
AQLEKEVLLLQSTLDSERRNYSQGSEEIRELQARMAGLQEDNKNLKLSLSKVESERKQAQ
ERSNNLEKEKNNLEIDLNYKLKTLQQRLEQEQTEHRVTRAQLTDKYESIEEAKSAAMNAV
QQKMSEENGARMRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEDEVKSLRIQV
EQESSKRLLAQSDLKNRTQEVDRLRCSEKQLKQEINTALESKRSLEFQLAQLTKQYRGNE
GQMRELQDQLEAEQYFSTLYKTQVKELKEEIEERNRQVQEAHKKVQELCSERDSLSAQLD
LTVTKAESEQLARALQEEQYFELSQENKKAATRHKQEVGEKEATIARLEESNKTLTKDVE
NLSKEKADLNEKLRTQEEEYVAQKEEIANTIKANYEKVLNTERTLKTQAVNKLAEIMNRK
DMKLDQKKKGSTADLRKKEKENRKLQLELNQEKEKFNHMAIKYQKELSEMQAQLAEECTY
RNELQMQLDSKESDIEQLREKLNDLQQRMDNSSVTSLQTDETDSNIAESRLEGWLSIPNR
ANIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETE
EIPRIFQILYANEGECRKEADMETVPQGDKTNCLPHKGHEFIPTLYHFPSNCEACAKPLW
HVFKPPPALECRRCHVKCHKDHLDKKEDVIAPCKVNYDVTSARDMLLLALTQDEQKKWIG
HLGKKIPKTPPSTFSRASPRSMSTRSGPNQSFRRNPKSNTGKLSRAQSSLQAADTTSSTC
NT seq 4143 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctggagaaggtatcgaggctcgatttgaaaaaatcgatgccatgttgaaggac
ccaaagtcagaaataaatacggattgtcttctggatggcttggatgcactggtgtacgac
cttgacttccctgccctgaggaaaaacaagagcattgacaactttttgaatagatacaag
gaaaccattagtaaaattcgtgatctacgcatgaaagcagaagactatgaggtggttaaa
gttattggaaggggtgcatttggagaggtgcagttggtaaggcacaaagccacgagcaaa
gtatacgccatgaagctgctgagcaagtttgagatgatcaagaggtcagactctgctttc
ttctgggaggagagggacatcatggcttttgctgacagcgcctgggtggtgcagctcttt
tttgctttccaagatgatcgctacctctacatggtgatggaatacatgcctggtggcgat
ttggttaacttgatgagcaactatgacgtcccagaaaagtgggcgcgcttttacacagct
gaggtggtgctggctctggatggaatccactccatgggcttcattcacagggacgtgaag
cccgataacatgttgctagacaaagcaggccacttaaaactggcagactttgggacctgc
atgaaaatgaacaaggatggtatggtacgatgcgacacagcggtgggaactccagactac
atttcacctgaggtactgaaatcccaaggaggagatggctattatggcagagagtgtgac
tggtggtcggtgggagtgttcctgtacgaaatgctagttggcgacactcctttctatgca
gactcactggtggggacctacagtaaaattatgaaccacaagaacgccctgaccttcccc
gaagacagcgacatctccaacgatgccaagaatctcatctgtgctttcctgactgacagg
gaagttcgacttggtcgtaacggtgtagatgagatcaagaggcatcctttcttcaagaat
gaccaatggacgtgggagaacattagagagacggctgctccagtagtgcccgaactgagc
agtgacattgacaccagtaactttgacgacattgaggaggatcggggggaggaggagacc
tttcccataccaaaggcctttgtgggcaaccagctgcccttcgtaggcttcacttactac
agtaatcagcaccttctgcgcagctctactgccacaaagaccagtgacaagcgtagcagc
tccacaaaggaagacaagagtcatctggaaaacctgcagaaacggatctaccatctggag
gagcagctccacagtgagatgcagctgaaggatgagttggagcagaaatgcaggacatca
aacaccaagattgacaaaataatgaaagaacttgacgaagaggcaaaccttaggaagagt
gcagaggccagcatgtctctgctggagaaggacaagatcatgctgcagcaccgattcacc
gagtaccaaagaaaagctgaccaggaggcagagaagaggcgcaatttggagaatgaggtg
tcaactttaaaggagcagcttgaagatatgaggaagatcagccagaactcgcaagcctcc
aatgacaagattgcccagctgcagaatcagctggaagaggccaacgacctgctgcgtgcg
gagtcggacacggcagcgaggctgaggaagagccacacggagatggcgaagtcaatgagc
cagttggagagcttgaaccgcgagctgcaggagaggagccgcggggcagacggagagaag
gcgcagctggagaaggaggtcctgcttcttcagagcaccctggactcggagaggaggaac
tacagccaaggatccgaggagatcagggaactgcaagcgaggatggcagggctgcaagag
gacaacaaaaacttgaagctcagcctctccaaagtggagtcagaacgcaaacaggctcaa
gaaaggagcaataacctggagaaggagaagaacaacctggagatagacctgaactacaaa
ctgaaaaccttgcagcagcgtctggagcaggaacagaccgaacacagggtgacgcgggca
cagctcactgacaaatacgagtctattgaagaagccaaatcagctgccatgaacgctgtt
cagcagaagatgtctgaagagaacggagcgaggatgagagctgagagccgggtagtggag
gttgagaagcagtgctcgatgctggagtttgacctcaagcagtctgtgcagaagatggag
cagctgatgaagcaaaaggaaaggctggaagatgaggtgaagagcctgcggatacaggta
gagcaggagtcaagcaagcgcctcctggctcagagtgacctgaagaaccgcacacaggag
gtggaccgtctcaggtgctcagagaagcagctcaaacaggagatcaacacagcactagag
agtaaacgctcgctggagttccagctggcacagctgaccaaacaatacagaggcaacgag
ggacagatgagggaacttcaggaccagcttgaggccgaacagtatttttctacgctttac
aaaactcaggtcaaggaactaaaagaggagattgaggaaaggaaccggcaggtacaagaa
gctcataaaaaggtgcaggagttgtgcagtgaaagggactccctgtctgcccagctggat
ctgacagtgaccaaggcggagtcagagcagctcgcccgggcacttcaggaggagcagtac
tttgagctcagccaggagaacaagaaggcagcgactagacataagcaggaggttggggaa
aaggaggccaccattgctcggctcgaggaatctaataaaactctgaccaaagatgtggag
aacctcagcaaagagaaggcagatttgaatgagaagcttcgtactcaggaagaagagtat
gtagctcagaaggaggagattgcaaatacaatcaaggccaactacgagaaggtcctcaac
acagagcgcacgctgaagactcaggcggtgaacaagctggcagagatcatgaaccgcaag
gacatgaagctggaccagaagaagaagggcagcactgccgacctgcggaagaaggagaag
gagaaccgcaagcttcagctggagctaaaccaggagaaagagaagtttaaccacatggcc
atcaagtaccagaaggagttaagcgagatgcaggcgcaactggcagaagaatgcacatat
cgcaacgagctgcagatgcagctggacagcaaggagagtgacatcgagcagctgcgggag
aaactgaacgacctgcagcagcgcatggataactcgagcgtcaccagtttgcagacagat
gagacagacagcaacatcgcagaatccagattggagggttggctgtccattcctaatcgt
gctaatatcaagcgatacggatggaagaagcagtatgtggtggtgagcagtaagaagatt
ctgttctacaacgatgagcaggataaggaacagtccaacccgtcaatggtactagatatc
gacaaactatttcatgtgagaccagtcactcaaggagacgtgtaccgggctgagacagaa
gagattccaaggatattccagattctttatgccaacgagggggagtgcaggaaggaggcg
gacatggagacggtccctcagggcgacaagaccaactgtctcccacacaaaggccacgag
ttcatccccacgctatatcacttcccttccaactgcgaggcctgtgccaagcctctgtgg
cacgtcttcaagccgcctccggcccttgagtgtcgccgctgccacgtcaagtgccacaag
gaccacctcgacaaaaaggaggacgttattgctccttgcaaagtaaattacgatgtgacc
tctgcccgggacatgctcctgctggccctgacccaagatgagcagaagaaatggatcggt
cacctgggaaagaagattcccaagaccccaccatctacattctcaagagcctctcctcgt
tctatgtccactcgctctggaccaaaccagtccttccgcaggaaccctaaaagcaataca
ggaaaactgagcagagcgcagtccagcctccaagcagcagacacaacatccagcacttgt
tga

DBGET integrated database retrieval system