KEGG   Lates calcarifer (barramundi perch): 108884823Help
Entry
108884823         CDS       T04895                                 

Gene name
mars
Definition
(RefSeq) LOW QUALITY PROTEIN: methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00450  Selenocompound metabolism
lcf00970  Aminoacyl-tRNA biosynthesis
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    108884823 (mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    108884823 (mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcf01007]
    108884823 (mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcf03016]
    108884823 (mars)
Enzymes [BR:lcf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     108884823 (mars)
Amino acid related enzymes [BR:lcf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   108884823 (mars)
Transfer RNA biogenesis [BR:lcf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    108884823 (mars)
 Prokaryotic type
   Other AARSs
    108884823 (mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C_3 Anticodon_1 GST_C GST_N_3 GST_N GST_C_2 HTH_23
Motif
Other DBs
NCBI-GeneID: 108884823
NCBI-ProteinID: XP_018534426
Position
Unknown
AA seq 928 aa AA seqDB search
MKLFVSEGNPHCLKVLAALGVTGVQCDIQYVNHEETVVPFLSRPALPALLLPSGLHLFSS
NAICQYLFEVNGQESSELCYQWLEWEATDLQPALLEALHMAVLQGKGSEVSKVLQGPLNY
LDQSLSKGNMPYLTGEAVSVADVVLWAALYPVLSESSLALGERKSVKSWFDRVAAMHSCQ
SAAQKVLQGKGLQGMKSYMQRQPAPRSSHCRDTQPCNSNPAECEEGERAVSEEEMEAAVL
TWSKDLNAGPLAADRQHPILPQEGKRNILVTSALPYVNNVPHLGNIIGCVLSADVFSRYG
RLRGWNLLFVCGTDEYGTATENKAREEGLTPQQICDKYHAVHSSIYKWFQIDFDFFGRTT
TEKQTEIAQNIFWRLHEHGFLVEDTVEQLRCENCQRFLADRFVEGTCPHCSYPEARGDQC
DKCGRLINAVELREPQCKVCRQTPVIRSSKHLFLDLPKLENQLEQWLEKSTSTGDWTVNA
KQITRSWLRDGLKPRCITRDLQWGTPVPHPDFKEKVFYVWFDAPIGYLSITANYTDKWEK
WWKNPQQVELYNFMAKDNVPFHSVVFPCSLLGAQDNYTLVSHLVATEYLNYEDTKFSKSR
GVGVFGDMAKDTGIPSDVWRFYLLYVRPEGQDSAFSWADMALKNNSELLNNLGNFINRAG
MFVTKFFEGCVPAMELQQEDKKLLAVVGWELQQYIQLMDKVKIRDALKHILNISRHGNQY
IQVNEPWKKIKGGDTERQRAGTVTGVSVNIACLLSVMLFPYMPSVSHTIRDQLNAPQSCI
NTMLQGSGSFVCTLRAGHRIGTVSPLFQKLEVDQIEALKKRFGGQQPEDEPPKKKTTAQS
AASAQPAAVPAPAAPAEVAAVNGVDPEKAKQLAQAVAEQGDKVRALKAQKAEKAVITAEV
AKLLDLKKQLAAAEGKSPEPAPQKSKKK
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcttcgtaagtgaaggcaacccgcactgcctgaaggtgttagctgcgttagga
gtgactggagttcagtgtgacatccagtatgtcaaccacgaagagacagtggtgcccttc
ctcagccgtccagctttgccagccctcctcctgccgagcgggctgcaccttttcagctcc
aatgccatctgccaatacctgtttgaagtaaatggacaagaatccagtgagctttgctat
cagtggcttgaatgggaggccacagatcttcagcctgcactgctcgaggctcttcacatg
gcagtgctgcagggaaaaggttcagaggtgtctaaagtcctccaggggcctctaaactac
ttggaccaaagcttgagcaaggggaacatgccatatttaacaggggaagctgtttcagtt
gctgatgttgttttgtgggctgcactgtacccagttttatctgagtcttcactagcactg
ggtgaacgcaagtctgtgaagtcttggtttgaccgcgtggctgctatgcacagttgccag
tctgctgctcagaaagtgctccagggaaaaggcctgcagggcatgaagagctacatgcag
aggcagcctgcccctcggagcagccattgcagagacacacagccatgcaacagcaaccct
gctgagtgtgaagagggagagcgtgcggtttcagaggaggagatggaggctgctgttctc
acctggagcaaagacttgaatgcgggcccgctcgctgcagacagacaacaccccattttg
ccacaggagggcaaacgaaacatcctggtgaccagtgccttgccttacgtcaacaatgtc
ccccacctgggcaacatcattggctgtgtcctcagcgctgacgtcttctccaggtatggc
cgtctgcgaggctggaacctgctgtttgtgtgcggcacagacgagtacggcacggctaca
gagaacaaggccagagaggagggcctgacgccgcagcagatctgcgacaagtatcacgcc
gttcactccagcatctacaagtggttccagattgactttgacttttttggcagaaccacc
actgagaagcagacggagatagcccagaatatcttctggcggctccatgagcacgggttc
ctggtggaggacacggtggagcagctgcgttgtgagaactgtcagcgtttcctggctgac
cgcttcgtagagggcacctgtcctcactgcagctacccagaagctcgcggcgatcagtgc
gacaagtgtgggcggctcatcaacgctgtggagctcagggaacctcagtgtaaagtctgc
aggcagactccagtcatccgctcctccaaacatcttttcctagacctgccaaagttagag
aaccagttagagcagtggctggagaagtcgaccagcactggagactggacggtgaacgcc
aaacagatcacccgctcctggctgagagatggactcaaacctcgctgcatcaccagggac
ctgcagtggggaacgccagtgcctcaccccgactttaaagagaaggtcttctacgtgtgg
ttcgacgcccccatcggttatctgtccattacagccaactacaccgacaaatgggagaag
tggtggaagaatcctcagcaggtggagctgtacaacttcatggccaaagacaacgtgcca
ttccacagtgtggtgttcccctgctccctgctgggagctcaagacaactacactctggtc
agccacctcgtcgccaccgagtatctgaattacgaggacactaagttctccaagagccgc
ggcgtcggcgtgtttggagacatggcaaaagacacgggcatcccgtccgatgtgtggaga
ttctacctcctgtatgtgcgtccagagggacaggactctgccttctcctgggctgacatg
gctctgaagaacaactctgagctgctcaacaacctgggcaacttcatcaacagagctggc
atgtttgtcaccaagttctttgaaggctgtgtgcctgcgatggagctacagcaggaagat
aagaagctgctggcggtggtgggctgggagctgcagcagtacatccagctcatggacaaa
gtcaaaatccgtgatgctctgaaacacatcctgaacatctctcgccatggcaaccagtac
attcaggtcaacgaaccctggaagaagatcaagggaggagacacagaaaggcagcgtgca
ggaacagtgaccggtgtctcggtgaacatcgcctgcttgctgtcagtgatgctgttccct
tacatgccatcggtcagccacaccatcagggatcagctcaacgccccgcagtcctgtatc
aacactatgttgcagggctctggcagctttgtttgtaccctgagagccggccaccgcatc
ggcactgtcagtccgttgttccagaaactggaggtcgaccagatcgaggctttgaagaag
agatttggtggacagcagcctgaagatgaaccgcctaaaaaaaagacgacagctcagagc
gctgccagcgctcagcctgccgctgtgccagctcctgctgctcctgctgaggtggcggcg
gtgaacggagtggacccagaaaaagccaagcagctcgctcaggctgtggctgagcagggg
gacaaggtgcgagcgctcaaagcccagaaggcggagaaggccgtgatcacagcagaggtg
gccaaactgttggacctgaagaaacagctggctgcagctgaggggaagagccctgagcct
gcacctcagaagagcaagaagaagtga

DBGET integrated database retrieval system