KEGG   Lates calcarifer (barramundi perch): 108884875Help
Entry
108884875         CDS       T04895                                 

Gene name
nmnat2
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00760  Nicotinate and nicotinamide metabolism
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    108884875 (nmnat2)
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     108884875 (nmnat2)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     108884875 (nmnat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 108884875
NCBI-ProteinID: XP_018534500
Position
Unknown
AA seq 307 aa AA seqDB search
MTETTKTHVILLSCGSFNPITKGHIHMFEKAREYLHKTGRFIVIGGIISPVHDSYGKPGL
VSSRHRLTMCQLAVQSSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
STTPVIGQPQNQTPPIYQSHNNMNHKPTAIKLWGKISESLGKICCVRPHVDRFTFVDENA
NLGTAMRYEEIELRILLLCGSDLLESFCIPGLWKDSDMEVIVGDFGIVVVPRDGADTERI
MNHSSILRKYKDNIIVVKDATNHPMAIVSSTKSRLALQHGDGHVVDYLSQPVIDYILQSQ
LYINASG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaccaccaaaacccacgtcatccttctgtcctgcggcagcttcaaccccatc
accaagggacacatccatatgttcgaaaaagccagagagtatctgcataaaacagggcgt
ttcattgtgatcggagggatcatctcaccggtgcacgactcctatgggaaacctggtctg
gtgtccagcagacatcgtctcaccatgtgtcagctggctgtgcagtcctctgactggatc
agggtggacccctgggagtgttaccaggacacctggcagacgacctgcagcgtgctggag
catcaccgcgacctgatgaagagagtcaccggctgtatcctgtccaacgtcaacacgccg
tccacgactcctgtgattggtcaacctcagaaccagactccgcccatctaccagagccac
aacaacatgaatcacaagcccacggccatcaagctgtgggggaagatcagtgagagtctg
gggaagatctgctgcgtccgcccgcacgtcgaccgcttcacctttgtcgatgaaaacgcc
aacctggggactgcgatgagatacgaggagatcgagttacgcatcttgctcctgtgtggc
agtgatctcctggagtccttctgcatccctggtctgtggaaggacagtgatatggaggtg
atcgttggggatttcgggattgtggtggttcctcgtgacggagcagacacagagagaatc
atgaatcactcctccatcctccgcaaatacaaggacaacatcatcgtggtgaaagatgcg
acgaaccacccgatggccatcgtcagctccaccaagagcagactggccctgcagcacggt
gacggtcacgtcgtggactacctgagtcagcccgtcatcgactacatcctgcagagtcag
ctgtacatcaacgcctcaggatag

DBGET integrated database retrieval system