KEGG   Lates calcarifer (barramundi perch): 108885155Help
Entry
108885155         CDS       T04895                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108885155
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lcf03041]
    108885155
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     108885155
Spliceosome [BR:lcf03041]
 Complex C
  Other components
   Step II factors
    108885155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 Flavi_DEAD T2SSE ABC_tran AAA_30 AAA_19 AAA_16 PhoH AAA_7
Motif
Other DBs
NCBI-GeneID: 108885155
NCBI-ProteinID: XP_018534872
Position
Unknown
AA seq 1190 aa AA seqDB search
MAALDEIKRLEYLSLVSKVCTELENHLGLNEKDLAEFVISLAEKHPIFEEFKAVLSENGA
DFTDTLIGNLLRIIHTMRPSPSTSKVQPEVKPKSEKDKLKEKYPALCKPDDSVWMVHPPQ
TEKDDEQVAAAAMKELEMLMPNVCGTSSDNRSDGNLHSDQSRGADRESGRKRSRSRSGSR
DRDGETNHKRRRKRVSRWSDRPPSPDRDTDNNNNSNNRGEKYWCDRPVDQPLPDEPVVGD
IYNGKISSIMQFGCFVQLEGLRKRWEGLVHISELRKEGRIANVADVVTKGQKVKVKVLSF
TGTKASLSMKDVDQETGEDLNPNRRRHLFTGVGDETMRNPDRPTESSMLEMEENLTEHKR
LTKITDLEKWEIKQMIAANVLPKEEFPEFDEETGILPKIDDDEDEDIEIDLVEEEPPFLR
GQTKWSLNMSPVKIVKNPDGSLSQAAMMQSALAKERREIKQAARTAEMDSIPTGLNKHWI
DPMPDYEGRQIAANMRGIGAMPIDLPEWKRYAFGGNQVSYGKKTELSILQQRESLPIFKL
KEQLIQAVHDNQILIVVGETGSGKTTQITQYLAEAGYTARGKIGCTQPRRVAAMSVAKRV
SEEYGCCLGQEVGYTIRFEDCTSTETVIKYMTHGMLQRECLVDPDMSQYSLIMLDEAHER
TIHTDVLFGLLKKTIQKRKDMKLIVSSATLDAVKFSQYFFEAPIFTIPGRTFPVEILYTK
EPETDYLDASLITVMQIHLAEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIIL
PVYSALPSEMQTRIFDPAPPGSRKVIIATNIAETSLTIDGIYYVVDPGFVKQIVYNSKTG
IDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVL
SLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLC
KMLIMSVHLGCSEEMLTIVSMLSVQNIFYRPKDKQAQADQRKTKFFQPEGDHLTLLAVYN
SWKNNKFSNPWCFENFIQARSLKRAQDIRKQMLSIMDRHKLDVVSCGKATMRVQKAICSG
FFRNAARKHPQDGYRTLIDQQVVYLHPSSTLFNRQPEWLVYHELVLTTKEYMREVTTIDP
RWLVEFAPAFFRVGDPTRLSRQKRQQKLEPLYNRYEEPNAWRISRAFRRR
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atggctgctttagacgaaataaaacgtcttgaatatttatctttggtgtcaaaggtgtgc
acggagttggagaatcatctgggattaaacgaaaaagatttggctgaatttgtcatcagt
ctcgccgaaaaacacccaatatttgaggaatttaaagctgttctttcagaaaatggagca
gatttcacagatacccttattggtaatttactcagaattattcacactatgcggccttca
ccatcaacaagtaaagttcagccagaggtcaagccaaagagtgaaaaagacaagctgaaa
gagaagtaccctgctttatgtaaaccagatgattctgtgtggatggttcaccctcctcag
acagagaaagatgatgagcaggttgcagcagcagccatgaaggagctggagatgcttatg
cctaatgtttgtgggacaagctctgataacaggtcagacgggaatttgcacagtgaccag
agtcgaggtgcagacagagaaagtggacgaaagcgaagtcgctctcgctccggatcaaga
gatcgtgatggagaaacgaaccacaaacggagaaggaaacgggtgtctcgctggagtgac
cgtccaccgagcccggacagagacactgacaacaacaacaatagcaacaacagaggagag
aagtactggtgtgatagacctgtggatcagcctctgccagacgagcctgttgtgggtgac
atctacaacggcaaaatcagcagcattatgcagtttggttgttttgtgcagctagagggc
ctcagaaaacgctgggagggtctggtgcacatctcagagttgcgcaaagaaggacgtata
gcaaatgtggctgatgtcgtcactaaaggccaaaaggtgaaagtcaaagttctgtcattc
actggaaccaaagccagcctcagcatgaaggatgtagaccaggagacaggggaggacctg
aaccccaaccgacgaagacacctgttcactggagttggagacgaaaccatgaggaaccct
gaccgccccactgaatccagcatgctggaaatggaggaaaacctaacagaacacaaacgg
ctcaccaaaataactgaccttgaaaaatgggaaattaaacagatgattgcagcaaatgta
cttcctaaagaagagttcccagaatttgatgaggaaacaggaatccttcccaaaatagat
gatgatgaagatgaagacatagagattgatctggttgaagaagaaccaccattcctgagg
ggacagactaaatggagcttgaacatgagcccagtaaaaatagtgaagaatccagatggc
tccctttcccaagcagccatgatgcagagtgctcttgctaaggagaggcgagagattaag
caggcggcccgcacagcagagatggattccatcccgactggtctcaacaagcactggatt
gacccaatgcctgactacgaaggaaggcagatcgctgccaacatgagaggcatcggtgct
atgcctattgatcttccagagtggaaaagatatgcctttggagggaaccaggtgtcttat
ggcaagaagacggagctttccatcctgcagcagagagagagcttgcctattttcaagctt
aaagagcagcttattcaggctgtccatgacaatcagatcttgattgtagttggagagaca
gggtctggaaagaccacacagatcactcagtacctggcagaggcaggttacactgcccgg
ggaaagattggctgtacgcagccgcgtcgtgtagccgccatgtcagtggccaagagagtc
tctgaggagtatggttgttgtctaggccaagaggtggggtacaccatccgtttcgaggac
tgcaccagtacggagacagtaatcaagtacatgacccacggtatgctgcagagggagtgt
ctggtggacccagacatgagccagtattctctcattatgctggatgaggcccatgagaga
acaatccacactgatgtgctgttcggtctgctcaagaagacgatacagaaacgcaaagac
atgaagctgatagtgtcctctgcaacactggatgctgtcaaattctcccagtatttcttt
gaagcgcccatcttcaccatcccaggaagaactttcccagtggagattctctacaccaaa
gagcctgagacagactacctggatgccagtctcatcactgtcatgcagatccatttagcc
gagcccccaggtgacatcctggtatttctgactggacaggaagagattgacaccgcctgt
gagatcctgtatgagcgaatgaagtcactggggcctgatgttcctgaactgattattctg
ccagtttattctgctctgcccagtgagatgcagactaggatttttgatcctgcacctcca
ggcagcagaaaggtcatcattgccacaaatattgctgagacgtctctgactattgatgga
atctactatgtggtggatcctggttttgtcaagcagattgtgtacaattccaagaccggc
attgaccagcttgtggtgactcccatatcacaggcccaggccaagcagagggcaggtcga
gctggcagaacaggcccagggaagtgttacaggctctacactgagagagcctacagagat
gagatgctcacgaccaatgtacctgagatccagagaaccaacttggccagcactgtgctg
tctctgaaggccatgggcatcaatgacctcctgtcctttgacttcatggacgctcctccc
atggagactctgatcacagccatggagcagctctacactctgggagctctagacgatgaa
ggattactcacacggctgggtagaaggatggctgagtttcctctggagcccatgctgtgt
aagatgttgatcatgtctgtccacctgggctgcagtgaagagatgctcaccatcgtctcc
atgctgtctgttcagaacatcttttatagaccaaaggacaaacaggcccaggccgaccag
aggaagacaaagttcttccagcctgagggagaccaccttacactgctggctgtctacaac
tcttggaagaacaacaagttctccaacccctggtgttttgagaacttcatccaggctcgt
tccttaaagagagctcaggacatccgcaagcagatgctgagcatcatggacaggcacaag
ttggacgtggtgtcttgtggaaaggccacgatgcgagtccagaaagctatttgcagtggt
ttcttcaggaacgcagccaggaagcaccctcaggatggctaccgtaccctgattgaccag
caggtggtgtacctccacccctccagcactttgttcaaccgccaaccagagtggcttgtt
taccatgagttggtgttgacaaccaaggagtacatgcgggaggtgaccaccatcgaccct
cgctggctggtggagttcgcaccggctttcttcagagttggcgaccccacacgcctcagc
aggcagaagaggcagcagaaacttgaacctctctacaaccgttacgaggagcccaatgct
tggaggatctcccgcgccttcagacgacgctga

DBGET integrated database retrieval system