KEGG   Lates calcarifer (barramundi perch): 108886040Help
Entry
108886040         CDS       T04895                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04020  Calcium signaling pathway
lcf04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    108886040
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108886040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lcf04030]
    108886040
G protein-coupled receptors [BR:lcf04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    108886040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Saf_2TM Gaa1 Fumarate_red_D
Motif
Other DBs
NCBI-GeneID: 108886040
NCBI-ProteinID: XP_018536164
UniProt: A0A4W6BR05
Position
Unknown
AA seq 437 aa AA seqDB search
MATASPQHLLDDVINTGQQQQEQQQQQEFLSSLETIVLTIFLAIIIIMTVFGNLLVMVAL
CKDRHLRKKKTNYFIVSLAFADLLVALVVMPFAAIELTTGQWRYGEIFCLVRTSLDVLLT
TASILHLCCIALDRYYAICCQPLVYRHKMTPVRVAVMLSGCWLIPTFISFLPIMQSWNAI
GIEDIIEERRALTGGSNDTSCVFLVNQPYALICSAVAFYVPLALMVLAYQRIYVTAMTHV
RQIETLQRAGSAPVTGTAPVITVRSSTSSDPSEHYRLRTTMTSSSSEQAPIVNSRMRVET
KAAKTLAIIMGCFCLCWAPFFITNVVDPFIHYSVPWQLWTAWLWLGYINSGLNPFLYAFL
NRAFRRAFLVILCCGDERYARQGSCSYRQTHRACSAASVNGTSMALRLSFLPNRSYSDNG
RTILANEQESQDSLGPL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcatcacctcaacatttgttggatgacgtaataaacacaggacaacaacaa
caggaacaacagcagcagcaggaattcctgagctcattggagacgattgtcctcaccatc
ttcctcgccatcattattatcatgacggtgttcggcaacctgctggtcatggtggcgctc
tgcaaggacagacatttacggaagaagaagaccaactacttcatagtgtcacttgcgttt
gccgacttgctggttgcactggtcgtgatgccctttgctgcgattgagttgaccactggc
cagtggcggtatggagagatcttctgcctcgtccgaacatctctggacgtcctgttaact
acggcatccatcctgcatctctgctgcattgcactggacaggtattacgcaatctgctgc
cagccgctggtctacagacacaagatgaccccagtgagagtggcagtgatgctcagcggc
tgctggctcatccccacattcatctccttcttacccatcatgcaaagctggaatgccatt
ggcatcgaggatattattgaggagaggcgagccttgactggagggtccaacgacacaagc
tgcgtgtttctggtcaaccagccttacgccctcatctgttctgcagtggccttctacgtc
ccattggccctcatggtcctggcctaccaacgcatctacgtcactgccatgacccacgta
cgacagatcgagacactgcagcgcgccggctctgctcccgttaccggaactgctccggtc
atcactgtgaggtcctccacttcctcagatccctcagagcactaccgccttaggacaaca
atgacttcctcctcctcagagcaggcccctatagtaaatagccgcatgcgcgttgagact
aaagcggcaaagacactggcaattataatgggttgtttctgcctatgctgggcaccattc
ttcatcaccaacgtggtggaccccttcattcactactcagtgccctggcagttgtggaca
gcctggctgtggctcgggtacattaactcagggctgaacccgttcctgtatgcctttctg
aaccgggcgtttcggagggcgtttctggtgatcctctgctgtggggatgagcggtatgca
cggcaggggagctgctcctacagacaaacccaccgagcgtgttctgccgcgtcggtcaac
gggacgtctatggcactgagattgtccttcctgccaaatcggagctacagtgacaacggg
cggacgatactggccaatgagcaggagtcccaggactctcttggaccactatga

DBGET integrated database retrieval system