KEGG   Lates calcarifer (barramundi perch): 108886274Help
Entry
108886274         CDS       T04895                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lcf01002]
    108886274
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcf04147]
    108886274
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108886274
Peptidases [BR:lcf01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   108886274
Exosome [BR:lcf04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108886274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_2 DLH Thioesterase Abhydrolase_3 Peptidase_S15 LIP Peptidase_S9 Lipase_3 BAAT_C TMEM191C
Motif
Other DBs
NCBI-GeneID: 108886274
NCBI-ProteinID: XP_018536538
Position
Unknown
AA seq 354 aa AA seqDB search
MKRRSVKQTDSSSGVSEAQRSDRAQRKEGTSSGWWLKRGLLAAFVIFILLPFSLRTLPEL
IQHLVYTHRVRVPFFIDLGRPADLSLNHTINMYLTSEEGISLGVWHTVPESQWKEAQGKD
LAWYQNALNDGSPVFIYLHGNTGTRAATHRVGVAKVLSALGYHVLVPDYRGFGDSTGEPT
EAGLTTDALYLYNWVKARSGNSLVVIWGHSLGTGVATNTAVKLVEQGVVCDGVILEGAFN
SARQKIPVNPFIWYYWKLPGTGYLFPEPWADNKVVFPTEENLKKMKSPILFLHSEDDHLV
PIQIAQQMYEVAVSAQNAERVKLVSFDGSLGYLHNGLYRDAHLPDIIKKFVLSL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaaggtccgttaaacagactgattcatcttccggtgtcagtgaagctcagagg
agtgacagagcccagaggaaggaggggacatcgtcaggatggtggctgaaaagaggctta
ttggccgcctttgttatctttattttgttgcctttctcgctcagaaccctcccagaatta
atccagcaccttgtttacactcacagagtcagggtgccgttcttcatcgaccttggccga
cccgctgatctctcccttaatcacaccatcaacatgtacttaacatcagaggagggaatc
tccctcggcgtatggcacacagtccctgaaagtcagtggaaagaggcacaggggaaggat
ctggcgtggtaccagaacgctttaaacgatggaagtccggttttcatatatcttcatggg
aacactggcacacgggcagccactcatcgggtgggagtggcaaaagtattgagtgcactt
ggttaccacgtgctggtgcctgactacagagggtttggagactccaccggggagccgact
gaggccggtctgaccactgatgccctctacttgtacaactgggtcaaagcacgcagtgga
aacagcctggtcgtcatctggggacactctctgggcaccggagtggccactaacactgca
gttaaactggtcgagcaaggtgtggtgtgtgatggtgtgatcctggagggagcgttcaac
agcgctcgacagaagattccagttaatccttttatttggtattactggaaacttccaggc
actgggtacttgttcccagagccgtgggcagataacaaggtcgtcttccccactgaggaa
aatctgaagaaaatgaaaagcccgatactcttcctccattcagaggacgatcacctagtt
cccattcagattgctcagcagatgtacgaggtagcggtgagcgcccagaatgccgagcga
gtcaagctggtgtcattcgacggctctctggggtatctgcacaacggcttatacagagac
gcccatctgcccgacatcataaagaagtttgtgctgtcgctgtaa

DBGET integrated database retrieval system