KEGG   Lates calcarifer (barramundi perch): 108886891Help
Entry
108886891         CDS       T04895                                 

Definition
(RefSeq) histamine N-methyltransferase-like isoform X1
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00340  Histidine metabolism
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    108886891
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcf04147]
    108886891
Enzymes [BR:lcf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     108886891
Exosome [BR:lcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108886891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_31 Methyltransf_12
Motif
Other DBs
NCBI-GeneID: 108886891
NCBI-ProteinID: XP_018537518
Position
Unknown
AA seq 299 aa AA seqDB search
MASPLKSLVNDDSRYQKSFQLFLERSSEHQCMQDFIHNKLPDILASIGNGKSHLNVIGVG
SGAGEIDLEILSELHMKHPGVTVDNEVVEPSSQQLHNYRGTAFIVLVSQKPGLDYIKFTW
NKMTASGFEEHWKVKNMTKKADFIHMIQMLYYVKDPGATINFFQSLLDKNGKLLIILVSG
ESGWGKLWRTYRNQLCNTEISQCVTTGDIKSFLDSRGVSYQSYELLSQMDITECFTEGDE
KGELLLDFLTEVLDFSKTASPELKAGVMELLRHPDCSVESNGKVIFNNNLGVIVIDQVS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccactgaagagtctggttaatgatgatagcaggtaccagaaatccttccag
ctttttctggagcgctcatccgagcatcagtgtatgcaggacttcatccacaataagctg
ccagacatactggccagcattggaaatggaaagtctcatctaaatgtcataggagttgga
agtggagctggtgagattgacttagagatactctccgagctccatatgaagcacccaggg
gtgactgtggataacgaggtggtggagcctagcagccagcagctacataactacagaggt
acagcctttatagttttggtgtcacagaaaccaggtttagactacatcaaatttacctgg
aacaagatgactgcctctgggttcgaggagcactggaaagtgaaaaatatgacaaagaaa
gctgacttcattcacatgatacagatgctgtactatgtgaaggatcctggagctaccatc
aacttcttccagagtctccttgacaagaatgggaagcttcttatcattctagtgtctggg
gagagcggttggggaaagctgtggcggacttacaggaaccagctttgtaacacagaaata
agtcagtgtgtgaccactggagacatcaaaagcttcctggactccaggggggtgagctac
cagagctatgagctgctgtctcaaatggatatcaccgagtgtttcactgagggggatgag
aagggagagctgctgcttgattttctcactgaggtgctggacttcagtaagacagcctca
cctgagctgaaagctggtgtcatggagttacttcgacacccagactgtagtgttgagtcc
aacggcaaagttatctttaacaacaaccttggagtgatagtcatagatcaggtctcttaa

DBGET integrated database retrieval system