KEGG   Lates calcarifer (barramundi perch): 108887300Help
Entry
108887300         CDS       T04895                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit-like
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04260  Cardiac muscle contraction
lcf04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108887300
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108887300
   04261 Adrenergic signaling in cardiomyocytes
    108887300
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lcf04040]
    108887300
Ion channels [BR:lcf04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108887300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin SUR7 DUF716 L_HMGIC_fpl MIG-14_Wnt-bd DUF202
Motif
Other DBs
NCBI-GeneID: 108887300
NCBI-ProteinID: XP_018538155
Position
Unknown
AA seq 341 aa AA seqDB search
MSSCSSRALTILSTVFGACGLLLVGVAVSTDYWLIMVEGIILQQNQSMEVKMALHSGLWR
VCFVAGSENGRCVASEYFTEPDIEITTENTANILKMVRTATPFPMVSLLFVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPREPEQFFNYYYGWSFA
FAASSFLLKEGAGVMSVYLFMKRYAEEEMYRPHPALYRPRLSDSSDYSGQFLHPESSWPP
PKRGRSTSEASSDISIQLNQAPPAPTKSSLQVGGQGSPPSGSSSAGSYQMPPQSASYPST
HTLPRSHSSHPQGQALPMAMPPSPIPPPHYHTHMQMSASPC
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgtgcagcagccgtgcgttgactatcctgtccacagtgttcggagcctgcggg
ctgctgctggtcggggtggccgtatccacggactactggctgatcatggtggagggcatc
atcctgcaacagaaccagagcatggaggtgaagatggcgctgcactcaggcctctggaga
gtttgcttcgtggctggatcagaaaacgggagatgtgttgcatcagagtacttcaccgaa
cccgatatagagattaccactgaaaacactgcaaacatcctcaagatggtgcgtacagcc
acgcccttcccgatggtgtccctgctcttcgtcttcacggccttcgtcatcagtaacatc
ggacacatccggcctcagcgcaccatcctggcctttgtgtccggcatcttcttcatcctc
tcaggcctcagtctggtggtgggcctggtgctctacatctccagtattaatgacgaggtg
atgaaccggcccagggagcctgagcagttcttcaactactactacggatggtccttcgcc
ttcgctgcctcttccttcttactaaaagagggcgccggggtgatgtcggtctatctgttt
atgaagcgttacgctgaggaggagatgtaccggccccacccggctctctaccgcccccgc
ctgtccgacagcagtgactacagtggccagttcctccatccagagtcctcttggccccca
ccgaagcgaggccgcagcacctccgaggcctccagtgacatctccatccagctcaaccag
gcaccaccagcgccgaccaagagcagcctccaagtgggcggccagggaagcccgccctct
ggttcctcttccgcggggagctaccaaatgccccctcagtctgccagctacccctccaca
cacaccctgcccaggtcacactcctcacatccccaaggccaggctctccccatggccatg
cctccatcgcccatacctccccctcactatcacacacacatgcaaatgagcgcctccccc
tgttag

DBGET integrated database retrieval system