KEGG   Lates calcarifer (barramundi perch): 108888465Help
Entry
108888465         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent calcium channel gamma-3 subunit-like
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04260  Cardiac muscle contraction
lcf04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108888465
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108888465
   04261 Adrenergic signaling in cardiomyocytes
    108888465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lcf04040]
    108888465
Ion channels [BR:lcf04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108888465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 108888465
NCBI-ProteinID: XP_018539975
Position
Unknown
AA seq 332 aa AA seqDB search
MRLCNRGAMMLLTTAGAFCAFSLMTIAVGTDYWLYSRGMCRSKSLSDNETVRKNEEVLTH
SGLWRTCCTEGTFRGVCKDIDHFPEDADYEQDAAEYLLRAVRASSLFPILSVGLLFLGGV
CVAASEFYKSRYNVILSAGILFVSAGLSNIIGIIVYISANSGDPSQSDNKKSYSYGWSFY
FGALSFVLAEMVGVLAVHVFIEKHRQLRTKGRPSLIKPPISRSSSYYRNRYYQNRCRRYS
YRSNHSAGDSTSHSFRASLVQDREPALSSESKVXGLPTPVTVGSEFMLYTLTSPLKDGKI
DMTADDLTAAAAHNNTEMLPGNCTANRRTTPV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgtgtaaccggggtgcgatgatgctgctgaccacggcgggggctttctgcgcc
ttcagcctcatgaccatcgccgtgggaacggactactggctgtactcccgcgggatgtgc
cgctccaagagcctgagcgacaacgagaccgtccgcaagaacgaggaggtcctgacccac
tccggtctgtggaggacctgctgcacggaggggacgtttcgtggtgtttgcaaagacatt
gatcattttcctgaagatgcagactatgagcaggatgctgcagagtatttattacgagca
gtacgagcctccagcctcttccccatcctcagcgtggggttattatttctcggaggtgtg
tgtgtagctgccagtgagttctacaagtcgcgctacaatgtcatcctcagcgcggggata
ctctttgtctctgcaggtctcagtaacatcattggcatcattgtttacatatcagccaac
tcaggtgaccccagccagagtgacaacaagaagagctactcctacggctggtctttttat
tttggggctctgtccttcgtgctggctgagatggtgggcgtcctggcagtgcacgtgttc
atagagaaacacaggcagctgcgcactaaaggccggccttccctcatcaagcctcccatc
tcccgcagctcatcttactaccgcaaccgttactaccagaaccgctgccgccgatacagt
tacaggagcaaccacagcgcaggggactcgacctcgcactccttccgggcgtctttggtg
caagaccgagagccggccctgtcctctgaatccaaagttngcggtttgccaacaccagtg
acagtgggttcagagttcatgctctacaccttaacctcaccactcaaagacggtaagatt
gacatgacagcggatgatttaactgctgcggctgctcacaacaacacagagatgctgcct
ggaaactgcactgccaacagaaggaccacgcctgtgtga

DBGET integrated database retrieval system