KEGG   Lates calcarifer (barramundi perch): 108888962Help
Entry
108888962         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: palmitoyltransferase ZDHHC5-like
  KO
K20030  palmitoyltransferase ZDHHC5/8 [EC:2.3.1.225]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcf04131]
    108888962
Enzymes [BR:lcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     108888962
Membrane trafficking [BR:lcf04131]
 Protein recycling
  Others
   GRIP associated proteins
    108888962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 108888962
NCBI-ProteinID: XP_018540730
Position
Unknown
AA seq 799 aa AA seqDB search
MPASGADSLKPSAFIPVCTAACLLVGSTSLFFVFTCPWLAVTICPAVPPCCAILFLFVLA
NFTMATFMDAGVLPVANEDEDKDDEFRAPLYKNVDVKGVQVRMKWCASCHFYRPPRCSHC
SVCDHCVEDFDHHCPWVNNCIGRRNYRYFFLFLSSLTVHMICVFTFGLIYILHHMDELWK
LHCTVTLVVISISGLFLIPVLGLTGFHLYLVSRGRTTNEQVTGKFQGGVNPFTRGCCNNL
EYLVCSPISPKYTARPYKKTLIHVQPPFLRPEISRQMPVKVRDNGIQSQDLQTKQTSAGA
VELSDIKQLKTPPPLPPKPDHGLLKSHLAAMDEMGHHTKSIIPVSIPTVPQLRPVLEAIS
RGSSPIPPEQLLKTSEQQGNSKSPDLRSESRESPARGRQQAGLPVQPPLQTSTASGSLQL
NSLTLNSRSLTLKHSNRHAMHADGLGSNPPLGIVSSSSLLANHSSSSSSSLSYDNLISPA
DPQFLRGAPPVSYHTHFMTLGTDGTVLQRTPPHAYSPVFMGMTRQSPQPREPSPSLKGLT
SRDPSPSFQGFIQRDPSPAFQGLMPRDLASQSVATRDVPPPGLAMRDMTSQSLRDSLRDL
GPQSLTPPKSAAARYDNFSKSIMASIHERQEMEERERMLRLQARSQALYGPDMGIYDIPS
RRSLPPDNIRPPGSRGLTPPAYGSREFLMSTGILGYGMRTSPLSSSSTSSLTRGPKTSSS
PLQSSSSSSLQSKGRSSSPAYCPTDRQTQPLPSSTSTLPRLPSSSTSSAPSYASYAAAKR
SSLTYSSEGKDSITLGALK
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccagcggcgccgactcgctgaaacccagcgccttcatcccggtgtgcacggcc
gcttgcctcctggtcggctctacctccctgttcttcgtcttcacatgcccgtggctggct
gtgaccatctgccctgctgtgccaccatgctgtgccatcctcttcctttttgtgctggcc
aacttcaccatggcaacctttatggatgctggtgtcctcccagtcgctaatgaggatgag
gacaaagacgacgagttccgcgctccgctgtacaagaacgtggacgtgaagggcgtccag
gtgcggatgaagtggtgcgcttcgtgtcatttctacagaccgccacgctgctcgcactgc
agcgtctgcgatcactgtgtggaggactttgaccatcactgtccctgggtgaacaactgc
atcgggaggcgcaactaccgctacttcttcctgtttctgtcgtcgctgacagttcatatg
atctgcgtcttcacctttggcctcatatacatcctgcaccacatggacgaattatggaag
ctgcactgcactgtcactttggtagtgatcagtatatcagggctgtttcttatcccggtc
cttggtctcactggattccacttgtaccttgtgtccagagggcgcaccacaaatgaacaa
gtaactgggaagtttcaaggtggagtaaatcctttcacacgaggttgttgtaacaacctg
gagtatctggtttgcagtcctatctctccaaagtacacagcaaggccctataagaaaacg
ctcatccacgttcaacctccgttcctgagaccagagatcagcaggcagatgccggtgaaa
gtcagggacaacgggatacagagtcaagacctccaaactaaacaaacctcagccggagct
gtcgagctgtcagacatcaagcagctgaaaactccaccaccactgccaccaaaaccagac
catggcctgttgaaaagccatctagctgccatggatgagatgggacatcataccaaatcc
atcattcctgtatccattcccactgtgccacagctacggccagtcctggaggccatatcc
agaggatcatcacccatccccccggagcagttgctgaagacatcagagcagcaagggaac
agcaaaagtcctgacctccgctctgagtccagagaaagccctgcgagaggcagacagcag
gcgggcctacctgtccagcctcccctccagaccagcaccgcctccggctcgctgcagctc
aactctctgactctcaactcccgctccctcaccctcaaacacagcaaccggcacgccatg
cacgctgacggtttgggatccaatcccccgctgggcatcgtctcttcctccagcctgctg
gccaaccacagcagcagcagcagcagcagcctctcctatgataacctcatcagccctgca
gaccctcagtttctgagaggggcccctccagtcagctaccacactcacttcatgaccctg
ggcacggatgggactgtgttgcagcggacccctcctcacgcctacagtcctgtgtttatg
ggcatgaccagacagtctccccagcctcgagaaccctcgccctctttgaagggtctcacc
tcaagggatccctcgccctccttccaaggtttcattcaaagagacccttctccagctttt
caagggctgatgccgagagaccttgcatcccaaagtgtagcaacgcgagacgttccacct
ccaggtctggccatgcgagacatgacctctcaaagtcttcgagacagcctccgtgatctt
ggtccgcagagcttgacacctccgaagtctgctgctgcgcgctacgacaacttttcaaaa
agcatcatggcatccatccacgagagacaggagatggaggagagggagaggatgctgcgt
ctccaagccagatcccaggcgctctatggcccggacatggggatctacgacatccccagc
aggcggagtctaccaccggacaacatccgacccccaggctcccgtggactgacgcctccg
gcctatggctccagggagtttctgatgagcacgggtatcctcggttacggcatgaggacc
tcgcccctgtcgagctcctccacgtcgtccctgacgcgaggcccgaaaacctccagctcc
cctctgcagagcagcagcagcagcagcctgcaaagcaaaggcaggtcttcctctccggcc
tactgccccaccgacagacagacgcaacctctcccttcctctacgtccaccctgccccgt
ttgccttcctcctccacctcctctgccccgtcctacgcctcgtacgctgccgcgaagcga
tcctcgctcacatactcctctgaggggaaggactcaatcaccctgggagccctgaaataa

DBGET integrated database retrieval system