KEGG   Lates calcarifer (barramundi perch): 108890168Help
Entry
108890168         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor 1-like
  KO
K05197  glutamate receptor 1
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108890168
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lcf04040]
    108890168
Ion channels [BR:lcf04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   108890168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan Lig_chan-Glu_bd ANF_receptor SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 108890168
NCBI-ProteinID: XP_018542509
Position
Unknown
AA seq 864 aa AA seqDB search
MNDSDFSLSPSDVEVFKTACSVVEDSPVSELLAWWQTPGLAVTYIRCSGLIELVYRVSAD
GVSSGLSVLQRILDTAAERTWQVTSVNLDTLTEASFIKLLADLDYKKDYQIIIDCELDRL
NSILNLIAAQRRNLKNYHYILANLGFMDLNVTEFQKLGPNVTGFQLVNRSDPAVEKINQD
WLDFDSKDLKLARRRLRYTGALTYDGVSVMATAFQNLRRQRIDISRRGNAGECLANPPAP
WGQGIDIQRALQQVRLEGLTGHVQFDERGHRTNYTLSVMELSHTGPRKIGYWNEKRGYVN
TAIYRPVVEEFYGLQNRTYIVTTILEAPYMMLKKNHEQFVGNDKYEGYCAELASEIAKHV
GFAYRLELVGDGKYGARDPETKMWNGMVGELVYGKADVAVAPLTITLVREQVIDFTKPFM
SLGISIMIKKPTKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWKGEDS
DDEDETLPSSTSRRALPTSSSELTHSPGYSQGQNQNQNQQKEKETPEHTNDFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
AKQTEIAYGTLDGGSTKEFFRRSKIAVFEKMWSYMRSADPSVFVKNTNEGVSRVRKSKGK
YAYLLESSMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSPLRIPVNLAVLKLNEQAVL
DKLKNKWWYDKGECGHKDSGRKDKTSALSLSNVAGVFYILIGGLGLAMLVALVEFCYKSR
IESRRMKELIDAAMMSTSLRGMAGGAGGGGGGGMAVMGGLGGGGASGLGGENGRVVAHDF
PKAGAQGLPCMSKAAGLGLSSTGM
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacagtgacttcagcctgtcaccatcagacgtggaggtttttaaaactgcctgt
tcggttgtagaggactctcctgtgtctgagctgctggcgtggtggcagactcccggtctc
gctgttacctacatcaggtgttcaggtttgattgagctggtgtatcgtgtttctgctgac
ggtgtgagctcaggcctgtcagtgctgcagaggatcttggacacggcggcggagcggacc
tggcaggtcacctccgttaacttggacactctgacagaagcgtccttcatcaagctgctc
gccgacctcgactacaagaaggactatcagatcatcatcgactgcgagctcgaccgactc
aactccatcctcaacctgattgctgctcagaggagaaacttgaagaactaccattacatc
ctggccaatctgggtttcatggacctgaacgtcacagagtttcagaagctggggccgaac
gtgacgggcttccagctggtgaaccggtctgatccagctgtggagaagatcaaccaggac
tggctggacttcgacagcaaagacctcaaactggctcgaaggaggctcaggtacacagga
gctttgacctacgacggcgttagcgtcatggcgacggccttccagaacctgcggcggcag
cggatcgacatctctcgccgcgggaacgcaggagagtgtctggccaatcccccggctccg
tggggacagggcatcgacatccagagagccctgcagcaggtgcgtcttgaaggcttgacg
ggtcacgttcagtttgatgagcgaggacatcgcaccaactacaccctgtctgtgatggag
ctcagccacactggacccaggaagatcggctactggaacgagaagagaggctatgtgaac
actgccatctacaggccagtggtggaggagttctacggtctgcagaacagaacctacatt
gtcaccaccatactggaagctccatacatgatgttgaagaagaaccacgagcagttcgta
ggaaacgacaagtacgaaggttactgcgccgaactggcctcagagatcgccaaacacgtt
ggcttcgcctaccgcctcgagctggtgggtgacggcaagtacggtgccagagatcctgag
acgaagatgtggaacggcatggtgggagaactggtgtacgggaaagccgacgtggcggtc
gccccgctcaccatcaccctggtccgagagcaggtgattgacttcaccaaacccttcatg
tctctgggaatctccatcatgatcaagaaacccaccaagtccaaaccgggcgtattctcc
ttcctcgacccgctggcctacgagatctggatgtgcatcgtcttcgcctacattggagtc
agcgtggtgctcttcctggtgagtcgtttcagtccttatgagtggaagggagaggactct
gacgacgaagacgaaactctgccttcctctacctctcgacgagctctgccaacttcatcc
tctgagctcacccactctccagggtactcccagggtcagaaccagaaccagaaccagcag
aaagaaaaggagactccagaacacaccaacgactttgggatctttaactctctctggttc
tctctcggggccttcatgcagcagggctgtgacatctcccccaggtcactctcaggccga
atcgttggaggagtttggtggttttttaccctcatcatcatctcctcctacacagccaac
ctggcagccttcctcactgtagagaggatggtctcccccatagagagtgcagaggacctg
gccaagcagacagagattgcctacggtactctggacggaggctccactaaagagttcttc
aggagatcaaagattgcagtttttgagaagatgtggtcgtatatgcggagcgcagaccca
tctgtgttcgtcaaaaacaccaatgaaggtgtgagtcgagtcagaaaatcaaaggggaag
tacgcctacctgctggagtcctccatgaacgagtacatcgagcagaggaagccctgcgac
accatgaaagtaggaggtaacctggactctaaaggctacggagtggccacgcccaaagga
tcgcctctcagaatcccagtaaacctagcagtactgaagctcaatgaacaagccgtctta
gacaagttgaaaaacaagtggtggtatgacaagggagagtgtggacacaaggactccggc
agaaaggacaagacgagcgcgctcagtctgagcaacgtggcgggagtgttttacattctg
atcggcgggctggggctagccatgctcgtggctctggtcgagttctgctataagtcacgg
atcgagtcgagaaggatgaaggagctgattgatgctgctatgatgagcaccagcctcagg
gggatggcgggaggagcaggaggaggaggaggcggtggcatggcggtgatgggaggttta
ggaggaggaggagcgtcgggactcggaggagagaacggtcgcgtggtggcgcacgatttc
ccaaaagccggagctcagggtttaccctgcatgagcaaggctgccgggctgggactgtcc
tccacgggcatgtga

DBGET integrated database retrieval system