KEGG   Lates calcarifer (barramundi perch): 108890672Help
Entry
108890672         CDS       T04895                                 

Gene name
qdpr
Definition
(RefSeq) dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00790  Folate biosynthesis
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    108890672 (qdpr)
Enzymes [BR:lcf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     108890672 (qdpr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short Epimerase adh_short_C2 Peptidase_S66 PRMT5 UCR_TM
Motif
Other DBs
NCBI-GeneID: 108890672
NCBI-ProteinID: XP_018543163
Position
Unknown
AA seq 236 aa AA seqDB search
MAANRVIVYGGRGALGSKCVQYFKSKGWWVASIDMVANEEANENVIVKMSESFTEQAGQV
TTDMAQLLGDQKVDAILCVAGGWAGGKCSSKDLYKNTDLMWKQSVWTSTISSHLAALHLK
PGGLLTLAGAKAALSGTGGMVGYGMAKAAVHQLCKSLGAENSGMPSGAAAVAILPVTLDT
PMNRKFMPDADFSTWTPLEYIAEVFFNWATGVNRPASGSLMQLLTSGGETQAVATQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaaccgggtgatcgtttacggagggagaggcgctctgggctccaagtgtgtc
caatatttcaagtccaaaggatggtgggtcgccagcatcgacatggttgcaaatgaggag
gcgaatgaaaacgtgatagtgaagatgagtgaatctttcactgagcaggcaggacaggtg
acgacagacatggctcagttgctaggggaccaaaaagtggatgccatcttgtgtgtggct
ggaggatgggcgggaggaaaatgtagttccaaagatttatacaaaaatacagatctgatg
tggaaacagagtgtgtggacctccactatctccagccacctcgccgctctgcacctaaaa
ccaggaggattgttgactttggccggagctaaagcagctctctcaggcactggaggcatg
gtgggctatggtatggccaaagctgccgtacaccagctgtgtaagagtctaggagcagaa
aacagtgggatgccatcaggagccgccgccgtggcgatattaccggttaccttggataca
ccgatgaacaggaagttcatgcctgacgcagatttcagtacctggacaccactggagtac
attgcagaagtgtttttcaactgggccaccggggtgaaccggccggcatcgggaagcctg
atgcaactgctgacctccggaggcgaaacccaggctgtggccactcagtag

DBGET integrated database retrieval system