KEGG   Lates calcarifer (barramundi perch): 108890687Help
Entry
108890687         CDS       T04895                                 

Gene name
aldh4a1
Definition
(RefSeq) delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00250  Alanine, aspartate and glutamate metabolism
lcf00330  Arginine and proline metabolism
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108890687 (aldh4a1)
   00330 Arginine and proline metabolism
    108890687 (aldh4a1)
Enzymes [BR:lcf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     108890687 (aldh4a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 108890687
NCBI-ProteinID: XP_018543179
Position
Unknown
AA seq 555 aa AA seqDB search
MLRVRAAVGWSWRGFKTFSCAAVEVKNEPILSFNEGSAERKELLKALDSVKGVTEEIPCV
VGDEHVWTKDIRYQLSPFNHSHKVAKFCYADKELINKAIVASMAARRDWDLKPIQDRAQI
LFKAADVISGPRRAEVLAKTMIGQGKTVVQAEIDAAAELIDFFRFNAKHAIELQKQQPLD
AEGSTNTMLYRGLEGFVAAVAPFNFTAIGGNLAGTPALMGNVVLWKPSDTAMSASYAVYR
VLRECGLPPNIIQFLPADGPVFGDTITSSEHLAGINFTGSVPTFKRLWKQVAENLDTYKT
FPGWQECGGKNFHFVHRSADVQSVVTGTIRSAFEYGGQKCSACSRMYVPDSMWPQIKQGL
LDIHRSIRVGDPVEDFSTFFSAVIDDKSFSRIKRWLDHAKSSPNLKVIAGGNCDDKKGYY
VEPTIIETKDPQDAIMNEEIFGPVLTVYVYPEKEYREVLQLIDSTSPYALTGAVFAQDQK
VIEEAAVVLRNAAGNYYVNDKSTGSIVAQQPFGGARASGTNDKPGGPHYVLRWTSPQVVK
QTHVPLREWRYPYMG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcgtgagggcggcggtgggttggtcctggagggggtttaagacgttctcctgt
gcagcagtggaggtgaagaatgagccgatcctgagcttcaatgagggcagtgcagagagg
aaagagctgctgaaggccctggacagtgtgaagggcgtgacagaggagatcccatgtgtg
gtgggggatgaacatgtgtggaccaaagacatcagatatcagttatcaccgttcaatcac
tcacacaaggtggccaagttctgttacgctgacaaggagctgatcaataaagccatcgtg
gcgtccatggcggcaaggagagactgggacctgaagccgatccaggaccgagcccagatc
ctgttcaaggccgctgatgtcatcagtggacccaggagagccgaagtcctcgccaagacc
atgatcggacaggggaagacggtggtccaggccgagatcgacgctgccgcagagctgatc
gacttcttcaggtttaacgccaagcacgcgatcgagctgcagaaacagcagccgctcgat
gcagagggaagcaccaacaccatgctgtacagaggcctggagggcttcgtcgcagctgtg
gctccttttaacttcactgcgattggtggaaacctggcaggaactccggctctgatgggg
aacgtggttctgtggaagcccagtgacacagccatgtctgccagctacgctgtgtacaga
gtcctgagggagtgtggtctgccccccaacatcatccagttcctgcccgctgacggcccc
gtgttcggagacaccatcacctcctctgagcacctggcaggcatcaacttcaccggcagc
gtcccgacgttcaagcgtctgtggaaacaagtggctgagaacctggacacctacaagacg
ttccccggctggcaggagtgcggagggaagaacttccacttcgtccacaggtctgcggac
gttcagagcgtggtgacggggaccatccgctcagcgttcgagtacggaggtcagaagtgt
tcagcctgttccaggatgtacgtccctgacagcatgtggccgcagatcaaacagggactc
ctggacattcacaggagcatcagagtgggagaccctgttgaagacttcagcaccttcttc
tctgctgtaatcgatgataagtcatttagtcggataaagaggtggctcgatcacgccaag
tcctcccccaacctgaaggtgatcgccggagggaactgtgacgataagaagggttattac
gtggagccgaccatcatcgagaccaaagacccgcaggacgccatcatgaacgaggagatc
ttcggtccagttctgacggtttatgtttatccagagaaggagtacagagaggttctgcag
ctgatcgacagcacgtctccgtacgctctgacaggagctgtgttcgctcaggaccagaag
gtgatcgaggaggccgccgtcgtcctcagaaacgctgctgggaactactacgtcaacgat
aaatccaccggctccatcgtcgctcagcagccgtttggtggagccagagcttcaggtacg
aatgacaaacccggaggtcctcactacgtcctgaggtggacgtccccgcaggtggtgaag
cagacccacgtccccctcagagagtggaggtacccctacatgggctga

DBGET integrated database retrieval system