KEGG   Lates calcarifer (barramundi perch): 108890756
Entry
108890756         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 4-like
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00230  Purine metabolism
lcf01100  Metabolic pathways
lcf04020  Calcium signaling pathway
lcf04114  Oocyte meiosis
lcf04261  Adrenergic signaling in cardiomyocytes
lcf04270  Vascular smooth muscle contraction
lcf04371  Apelin signaling pathway
lcf04540  Gap junction
lcf04912  GnRH signaling pathway
lcf04914  Progesterone-mediated oocyte maturation
lcf04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108890756
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108890756
   04020 Calcium signaling pathway
    108890756
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108890756
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108890756
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108890756
   04914 Progesterone-mediated oocyte maturation
    108890756
   04916 Melanogenesis
    108890756
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108890756
   04270 Vascular smooth muscle contraction
    108890756
Enzymes [BR:lcf01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108890756
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 DUF5408
Other DBs
NCBI-GeneID: 108890756
NCBI-ProteinID: XP_018543268
Position
Unknown
AA seq 1303 aa
MPDESQGFQVKGGVGGEASQVPDIVVDSSHGEGITRGNILELDEFSQTTDGIKQSAQSSD
INILQGGDSTKNRGDVSLGPTDGNETGLSESQVCVEVGVVKTAQAPEPLKANSLLRGTDN
SGSSQTNGSSDSDYSSTKSSPGYTSTSFSTDLCDGELSELDPSSFEKTNNISSVNFSEPS
LDAPESSKTTKTSPDENGDNSETDRMDKLKAENLLSDSSPVFTDVSSSDAQPRDSIDIRW
DDEDEEDDRRSTWSRRSVKDGVCCCYQAIHRAFLQCVEETPAMLSGLVLSLAFCVAIIVL
IPTTGRNISVHVGALAVVCIVLCLSAVLLVCLPWLATVRRCGGALALFVWGTLYITAIVF
IFTGGPVTTWEQVAFFLFLSLSVYTVLPLSLAWALMVGIGTSLSHIIIISVYVPVTSPET
PDLAVQLVANAVLFVCVNCVGIFHLWTTEHDLRLSNQKREEFSAIRSQKEIRKYQQEQLL
LSVLPRYIAMELKTEVIKRLSKPKGDKENESNFHNFHSLYIRQHKDVSILYADIVGFTKL
ASTCSPEELVAVLNKLFGRFDDIAKKNGCLRIKILGDCYYCVSGLPDPIPTHARNCVQMG
LDMCTAISKLREATGVEISMRVGVHTGNVLSGVIGLQKWQYDVWSHDVTLANHMESGGLP
GRVHITEETLQHLNGAYQVEEGDGGSRDALLKGRKTYLVIDPHKPDSVSRRPKLANSLAS
GETRQRASVRMSQYLQSWQTIHPFADLSNPKAKPTKKTIIPISAVTNQSQLTLERPPCQN
NTSCLVVDNSVRGSLDTIETAGRRAKKLNCLTLLFNDLSLEKQFRLSEVTGLHQSMSCLA
LIFVTLFAVQMLVSEKNFEMAVSYGATFPVLVLLLSITFTGYLEKWRSKMPVGVQWISGL
SRGIATRAALRLFVVTLCVLVTLLMAILNFFFLPGNNCTAIANTTELEGFKLYTVPYYLY
CCLLAMLGVIVFVRTCMSVKALLLTLAVVVYLALFLHVYAPRSYCLIDLLYNDTNPGVLK
DPQIMSGVWLVIFYIVCLILARQDELSCRVDFLLDRCFQMEREEMETMENVNKLLLQNVL
PLHVACFFMGKTVRNQDLYSQSYDCVCVMFASVPQFKEFYSESSANRDGLECLRFLNEII
ADFDELLSKPKFSSVEKIKTIGSTYMAAAGLTPPGDERKKCDMSLSHVRAMVEFAIALMG
KLELINTHSFNSFKLRIGINQGPVIAGVIGAHKPQYDIWGNSVNVASRMDSTGVLDKIQV
TEETAQVVQSVGYSVTLRGVVNVKGKGELTTYFINTDQSSPQF
NT seq 3912 nt   +upstreamnt  +downstreamnt
atgccagacgagtcacaaggttttcaggtcaaggggggggtgggaggagaggcgtcacag
gtgccggacatcgtggtcgattctagccacggggagggcatcaccagaggcaatatcctg
gagctcgacgaattcagtcaaacaacagatggcataaaacaatccgcacaaagcagcgac
attaacattttgcaaggaggtgacagcacaaaaaacaggggtgacgtcagtttaggtcca
actgacgggaacgagaccggactcagtgaatcccaggtttgtgtggaggtgggagtggtg
aaaactgcacaggcccctgagcctctcaaggccaattctttgttgaggggaacagacaac
agtggctcatcacaaacgaatggaagcagtgactctgactacagcagcacaaaatccagc
cctggttacactagcactagtttcagcaccgacctttgtgatggagagttatctgagctc
gacccaagctcgtttgaaaagacaaacaatatctcttcggtcaatttctcagagcccagt
ttagacgctcctgaatctagcaaaaccaccaaaactagtccggatgaaaacggagacaat
tccgaaacagaccggatggataaactgaaagcagaaaacttgctcagcgacagttcgccc
gtattcacagatgtttcatccagcgacgcccagccgagggacagcatcgacatcagatgg
gacgacgaggatgaggaggacgacaggcgaagcacctggtccaggcggagcgtgaaggac
ggggtgtgctgctgctatcaggcaatccacagggcttttctgcagtgtgtggaggagact
ccggccatgctgtctggactggtgctgtctttggccttctgtgtggccatcatcgttctc
attcctaccacaggaaggaacatcagcgtccatgttggcgctctggcagtggtgtgcatc
gtcctctgcctgagcgccgtcctgctcgtctgtctgccctggctggccacggtgaggcgc
tgcggaggagccctggccctcttcgtctgggggacgctgtacatcaccgccatagttttc
atcttcaccggaggacccgtcactacatgggaacaggtagcgttcttcctcttcctctct
ctaagtgtctacacggtgctgcctctgtctctggcctgggctctcatggttgggattggg
accagcctttcacacatcatcatcatcagcgtctacgtccctgttacgagcccagagacc
ccggacctggctgtgcagctggtggcgaacgcggtcctcttcgtgtgcgtgaactgcgtc
gggattttccacctgtggacgacggagcacgatctcaggctatccaatcagaagagagag
gagttcagcgccatccgttcccagaaggaaataaggaaatatcagcaggagcagctcctc
ttgtcggtgttgccacgctacatcgccatggagctgaaaacggaggtgataaagaggctg
tccaagccgaagggcgataaggagaatgaatccaacttccacaacttccacagcctctac
atacggcagcacaaagacgtcagcatcctgtatgcggacatcgtgggcttcacaaagctg
gcgagtacctgctctccagaggagctggtcgctgtgctcaacaagctctttggcagattc
gacgacatagccaagaagaatggatgtcttcgcattaagatcctgggtgactgctactat
tgtgtatctggtctgcctgaccccattcccacccacgctaggaactgtgttcagatgggg
ctggacatgtgcactgccatcagtaaactgcgtgaggcaacaggtgtggagatcagcatg
cgggttggcgttcacacaggcaacgtgctctctggtgtgatcggcttgcagaagtggcag
tacgacgtgtggtcacatgatgtgacgttagccaaccacatggagtctggaggtcttcct
ggacgagtccacatcacagaggagactctgcagcatttgaacggagcgtaccaagtggag
gaaggggacggggggagtcgggatgctcttctcaagggaagaaaaacctacctggtgatt
gacccccacaagccagacagtgtctcaaggaggcctaaactggcaaacagtcttgcctca
ggcgagaccaggcagcgggcgtcagtccggatgtctcagtacctgcagtcctggcagacc
attcaccccttcgctgacctgagcaaccccaaagccaaacccaccaagaagacgatcatc
cccatcagtgctgtcacgaaccagtcacagcttactctggaaagaccaccatgtcagaac
aacacctcctgtttggttgtggataatagtgtgcggggatccctggacacaatagaaact
gcagggagaagagcaaagaagctcaactgtttgactctgctgtttaatgacctcagcctg
gagaaacagttccgcctctcagaggtgacaggtttacaccagtcaatgagctgcttagct
ttgatcttcgttactcttttcgccgtccagatgcttgtctctgaaaagaactttgagatg
gcggtgtcctacggtgcgaccttccctgtgctcgtgctgcttctgtccatcactttcacc
ggatacttggagaagtggcgctccaagatgcctgtgggtgtccagtggatatcaggactg
tcccgcggcatcgccaccagggcggcactgcgactgttcgtggtcacgctctgcgtgctc
gtcaccctgctcatggcaatcctcaactttttcttcctgccaggaaacaactgcaccgct
attgcgaacacgacagagctggagggtttcaaactctacactgtgccctactacctgtac
tgctgcctgctggccatgctgggagtgatcgtgttcgtcaggacgtgcatgtcggtgaaa
gcgctgctgctcaccttggccgtggtggtttacctggcgctcttcctccatgtttacgcc
ccacgctcctactgcctcatcgacctgctttacaacgatacaaacccaggagtgctgaag
gaccctcaaatcatgtccggggtttggctcgtcatcttttatatcgtgtgtctcatactg
gccagacaggatgagcttagttgtcgtgtagacttcctgttggaccgatgtttccagatg
gagcgagaggagatggagaccatggagaacgtcaacaagctcctcctgcagaacgtcctg
ccgctccacgtcgcctgcttcttcatggggaaaactgttcggaaccaggacctgtacagc
cagtcatatgactgcgtgtgtgtgatgttcgcctcggtgcctcagttcaaagagttttac
agcgagagcagcgccaacagggacggcctggagtgtctgcgcttcctcaacgagatcata
gcagactttgacgagctcctctccaagcccaaattctcatcagtggagaaaatcaaaaca
atcggcagtacgtacatggctgctgcaggcctgactcctccaggggatgaaagaaagaaa
tgtgacatgtccctcagtcatgtgcgcgccatggtggagtttgccatcgctctgatgggc
aaactggagctgatcaacacacactctttcaacagcttcaaactcaggatcggaataaac
cagggtccagtgatcgctggggtgattggagctcacaaacctcagtatgatatctggggg
aactctgtgaacgtggccagcaggatggacagcacaggagtgttggacaagatccaggtg
acggaggagacggcccaggtggtccagagcgtaggatacagcgtcaccctcaggggagta
gtcaacgtcaagggcaaaggggagctcaccacctattttattaacacggaccaatcgtct
cctcagttctga

DBGET integrated database retrieval system