KEGG   Lates calcarifer (barramundi perch): 108890837Help
Entry
108890837         CDS       T04895                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108890837
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lcf04030]
    108890837
G protein-coupled receptors [BR:lcf04030]
 Rhodopsin family
  Lipid
   Leukotriene
    108890837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Serpentine_r_xa
Motif
Other DBs
NCBI-GeneID: 108890837
NCBI-ProteinID: XP_018543366
UniProt: A0A4W6EG75
Position
Unknown
AA seq 378 aa AA seqDB search
MASNITTTISQQAAPASSSLSVSAQIGITILTLAFVLGFPGNLFVAWSVLCQVKKRSVTC
LLVLNLALADAFVLLSAPLFLRYLAGGRGWEFGSAACKLVHYLSSVNMYVSIYLICLMSM
DRWLAVTKPFLSQRMRTKRSLLVLLLVVWVMAFILSLPMPFYRSNVKIPLPNITLYLCKP
YHWNSVGHKVFQYLFETIMGCVVPFSLINTCYASVICRLQNARFHRRGQGSRLILMIICA
FAVFWLPYHIVNIIEVIGLLQGSDSVMKAAQTARPNVTAFAYFSSAINPILYVFAGSSHI
RQAGLSFMGKLFEATYSESRSTSTFTRSGRSSSPDESSALQTLSVKLGKPFKSKNKEKSS
SSGVSKDIETLASVDQLE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaatatcaccaccaccatctcccagcaggccgcccctgcctcctcttctctg
tctgtctcagcccagattggcatcaccatcctcaccttggcatttgtgctgggcttcccc
gggaacctgtttgtggcctggtcggtgctctgccaggtcaagaagcgctcagtgacctgt
ttgttggtgctgaacctggctctggcagatgcctttgttctgctcagcgcccctcttttt
ctgcggtacctggctggaggccgaggctgggagtttggctcagcagcgtgcaaactggtg
cactacctgtcaagtgtgaacatgtacgtctccatctacctcatctgcctgatgagcatg
gaccgctggctggctgtcacgaagccttttctgtcccagagaatgaggaccaagcgttcc
ctcctggttctcctgcttgtggtctgggtgatggcgttcatcctgtcactgccgatgcct
ttttaccgcagcaatgtgaagataccactaccaaacatcactttgtacctttgtaagccg
taccactggaacagcgtgggtcacaaagtcttccagtacctgtttgagaccatcatgggc
tgcgtggtgcccttctccctcatcaacacgtgttacgcctccgttatctgccgtctgcag
aatgcaaggttccaccgcagaggacaaggcagccgtctgatcctgatgataatttgtgcc
ttcgcagtattctggctgccctatcacatcgtcaacatcatagaggtgattggtctgctg
caaggcagtgattcagtgatgaaggctgctcaaacagcccgcccaaatgtcacggccttt
gcctacttcagcagtgccatcaatccaatcctctacgtgtttgctggcagctcccacatc
cgtcaggccggcctcagcttcatgggcaaactgtttgaggccacctactctgagagcagg
agcacgtccaccttcacccgcagcggccgcagcagctctccggatgagagctccgccctg
caaacgctgtcagtcaaactggggaagcctttcaaaagcaagaacaaggagaagagcagc
agcagcggggtgagcaaggacattgagactctggccagtgttgaccagctggagtag

DBGET integrated database retrieval system