KEGG   Lates calcarifer (barramundi perch): 108892190Help
Entry
108892190         CDS       T04895                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf03040  Spliceosome
lcf04010  MAPK signaling pathway
lcf04141  Protein processing in endoplasmic reticulum
lcf04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108892190
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108892190
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108892190
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108892190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lcf01009]
    108892190
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lcf03041]
    108892190
   03009 Ribosome biogenesis [BR:lcf03009]
    108892190
   03110 Chaperones and folding catalysts [BR:lcf03110]
    108892190
   04131 Membrane trafficking [BR:lcf04131]
    108892190
   03051 Proteasome [BR:lcf03051]
    108892190
   03029 Mitochondrial biogenesis [BR:lcf03029]
    108892190
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcf04147]
    108892190
Protein phosphatases and associated proteins [BR:lcf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108892190
Spliceosome [BR:lcf03041]
 Complex B
  Other components
   Prp19 complex
    108892190
 Complex C
   Prp19-CDC5 complex
    108892190
Ribosome biogenesis [BR:lcf03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108892190
Chaperones and folding catalysts [BR:lcf03110]
 Heat shock proteins
  HSP70 / DNAK
   108892190
Membrane trafficking [BR:lcf04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108892190
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108892190
Proteasome [BR:lcf03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108892190
Mitochondrial biogenesis [BR:lcf03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108892190
Exosome [BR:lcf04147]
 Exosomal proteins
  Proteins found in most exosomes
   108892190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C MetOD2
Motif
Other DBs
NCBI-GeneID: 108892190
NCBI-ProteinID: XP_018545138
Position
Unknown
AA seq 639 aa AA seqDB search
MSAAKGVAIGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VALNPSNTVFDAKRLIGRKFDDSVVQADMKHWPFKVISDGGKPKIQVEYKGEDKAFYPEE
ISSMVLVKMKEIAEAYLGQKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGKSGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMV
NHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTSIT
RARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRE
LNKSINPDEAVAYGAAVQAAILTGDTSGNVQDLLLLDVAPLSLGIETAGGVMTSLIKRNT
TIPTKQTQVFSTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTF
DIDANGILNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDADKYKAEDDLQRDKISA
KNSLESYAFNMKSSVQDENLKGKISEEDQKKVIEKCDETITWLENNQLADKEEYQHKQKE
LEKVCNPIISKLYQGGMPASSCREEARAGSQGPTIEEVD
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagctaaaggtgtagcgatcggtatcgacctgggcaccacctactcctgtgtg
gggattttccagcatgggaaagtagaaatcatcgccaacgaccagggcaacaggaccacc
cccagctatgtggccttcactgacaccgagaggctgattggggacgccgccaagaaccag
gtggctctgaaccccagcaacactgtgtttgatgccaagagactgattggaagaaagttt
gatgattcagtggtgcaggctgacatgaagcactggcccttcaaggtgatttcagatgga
gggaagcccaaaattcaggtggagtacaaaggtgaagacaaagccttctaccctgaggag
atctcctccatggtcctggtgaagatgaaggagatcgctgaggcctacctcggccaaaag
gtgtccaacgctgtcatcacagtcccggcgtacttcaacgactcccagcgacaggcgact
aaagacgcaggcgtcatcgcaggactgaacgtcctgaggatcatcaacgagccgacggca
gccgccatcgcgtacggtctggacaaaggaaagtcaggagaacgtaacgtcctgatcttt
gacctgggtggaggcaccttcgacgtgtccatcctgacaatcgaagacggtatctttgag
gtgaaagccacggccggagacactcacctgggtggagaggactttgacaatcgcatggtc
aaccactttgtggaggagttcaagaggaaacacaagaaagacatcagccagaacaagaga
gccctgaggaggctgcgcacagcttgtgaaagggccaagaggaccctgtcctccagctcc
caggccagcattgagatcgattctctgtttgagggcatcgacttctacacctccatcacc
agggctcgctttgaggagctgtgctccgacctgttcaggggaacattagagccggtggag
aaagccctgagagacgccaaaatggacaaggctcagatccacgacatcgtcctggtggga
ggctccacccgaatccccaaaatccagaaactcctgcaggacttcttcaacggcagggag
ctgaacaagagcatcaacccagatgaggcggtggcttacggcgccgccgtccaggctgcc
atcctcacaggtgatacctcaggcaacgttcaggacctgctgctgctggacgtggcgcct
ctgtccctgggtatcgagacggccggaggagtcatgacgtccctgattaaacgcaacacc
accatccccaccaaacaaacccaggtgttctccacctactctgacaaccagcccggggtc
ctcatccaggtgtacgaaggagaaagagccatgaccaaggacaacaacctgctgggcaag
tttgagctgacaggaatccctcctgctcctcgaggggtcccacagatcgaggtcaccttc
gacattgacgccaacggcattttgaacgtgtctgcggtggacaaaagcaccggcaaagaa
aacaagatcaccatcaccaacgacaagggccgactgagcaaagaggagatcgagaggatg
gtgcaggacgctgacaaatacaaagctgaggacgaccttcagagggacaagatctctgcc
aagaactccctggagtcctacgccttcaacatgaagagcagtgtgcaggatgagaacctg
aagggcaaaattagtgaggaggaccagaagaaggtgattgagaagtgtgacgagaccatc
acctggctggagaacaaccagctggctgataaagaggagtaccaacacaagcagaaagag
ctggagaaagtgtgtaaccccatcatcagcaagttgtatcagggaggaatgcctgcaagt
agctgtagggaggaggcacgagccggctcccaggggcccactattgaggaggtggactaa

DBGET integrated database retrieval system