KEGG   Lates calcarifer (barramundi perch): 108892620Help
Entry
108892620         CDS       T04895                                 

Definition
(RefSeq) arginase, hepatic-like
  KO
K01476  arginase [EC:3.5.3.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00220  Arginine biosynthesis
lcf00330  Arginine and proline metabolism
lcf01100  Metabolic pathways
lcf01230  Biosynthesis of amino acids
Module
lcf_M00029  Urea cycle
lcf_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108892620
   00330 Arginine and proline metabolism
    108892620
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     108892620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 108892620
NCBI-ProteinID: XP_018545796
Position
Unknown
AA seq 245 aa AA seqDB search
MYLIDLFTFLIYKPRSIEIFVSLCFSLAIGSIHGHSAAVGELSVIWVDAHADINTPLTSP
TGNIHGQSMSYVLRELQSKIPVLPNFSWIRPCVSAKDLVYIGLRDVDPEEHYILKLLGVK
VFSMSEVDQLGIARVMEETCDYLFSKVKKPIHLSYDIDAIDPSVTPATGTPVVGGLTYRE
GVYITEQVCQTGLLSAVDMVEVNPLRGQTEEEVQSTVSTAVDLLCGCFGRLREGNHPSDY
RLPEP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaatagatcttttcacatttttaatctacaaaccaaggtctattgaaatcttt
gtttctttgtgtttcagtttggcgattggctccatccacggtcactcggcggcggtcgga
gagctgagcgtcatttgggttgacgctcacgctgacatcaacacgccactgacgtcgccc
actggaaacatccacggacagtcgatgtcgtacgtcctccgagagctgcagtccaagatt
cctgttttaccaaacttctcctggatcagaccgtgtgtttcggccaaagatcttgtctac
atcgggctcagggatgtggatccagaagagcattacatccttaaactgctcggtgtgaag
gtgttttctatgtctgaggtggatcagctgggtatagccagagtcatggaggagacatgt
gattacctcttttcaaaggtgaagaaaccgattcacctgagctacgacatagatgccatt
gatccttctgttaccccggcaactgggacacctgtagttggaggactcacctacagggag
ggagtctacatcactgagcaagtctgtcagacaggtctcctgtcagcagtggacatggta
gaggtgaatcctctgaggggtcagacagaggaagaagtccagtccacagttagcacagcg
gttgacctgctgtgcggctgtttcggacgtctacgtgagggaaaccacccgtcggattac
cgcctgcctgagccctga

DBGET integrated database retrieval system