KEGG   Lates calcarifer (barramundi perch): 108892646Help
Entry
108892646         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cyclin-dependent kinase 15-like
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcf01001]
    108892646
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     108892646
Protein kinases [BR:lcf01001]
 Serine/threonine kinases: CMGC group
  CDK family
   108892646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 108892646
NCBI-ProteinID: XP_018545849
Position
Unknown
AA seq 256 aa AA seqDB search
QTDLAQYMTQHPGGLHSHNVRIFMFQLLRGLCYIHSRRILHRDLKPQNLLISYXGELKLA
DFGLARSKSIPSQTFSSEVVTLWYRPPDVLLGSTDYSTALDMWGAGCIFIEMLQGAPAFP
GVTDVFEQLQKIWTVLGVPSEDNWPGVSCLPNYKPEWFHQSEPKQFRAVWKRLNQLPYKT
EDLVQRMLKGFPADRISAQDSLQHPYFSTLPPPIMHLRDTVSVFKVPGVHLETEVRDIFN
PGRRVRPSLLPAAKCW
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
caaacagacctggcccagtacatgacccagcaccccggaggtctgcactcacataacgtc
cggatcttcatgttccagctgctgcgaggtctctgctacatccacagccggaggatcctc
caccgagacctgaagcctcagaacctgctcatcagctacnctggagaactcaaactggcc
gactttggtctggctcggtccaagtccatccccagtcagaccttctcctctgaggtggtg
accctgtggtaccgcccccccgacgtgctgctgggatccacagattactccaccgccctg
gacatgtggggggccggctgtatcttcatcgagatgctgcagggggcgccggcattcccc
ggagtcactgatgtgtttgaacagctgcagaagatctggacggttttgggcgtcccctct
gaggacaactggcctggagtcagttgcctgcccaattataaaccagagtggtttcatcag
tctgagccaaaacagttcagggccgtttggaagaggctgaaccagttgccctataagact
gaggacctggtccagaggatgctgaaggggttccctgcagaccggatctcagctcaggac
tctctgcagcacccgtacttcagcacactgccccctcccatcatgcacctcagagacacc
gtgtccgtcttcaaggttccaggtgttcatctagagacggaggtcagagacatcttcaac
cccgggcggagggtcagaccctccctgctgcccgccgccaagtgctggtga

DBGET integrated database retrieval system