KEGG   Lates calcarifer (barramundi perch): 108893479Help
Entry
108893479         CDS       T04895                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1H-like isoform X1
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108893479
   04020 Calcium signaling pathway
    108893479
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lcf04040]
    108893479
Ion channels [BR:lcf04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108893479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 108893479
NCBI-ProteinID: XP_018547059
Position
Unknown
AA seq 1396 aa AA seqDB search
MDVKCQWESLHCLLHYIYMTTLITEYLCLKFIMTDFKGQREKQQEVALTIPVQGTCNPSS
MEEGQLPYPTLAPVVCFGLKQTTRLRNWCLKMTCGPWLDYASILVVLINCVTLGMYEPCE
ETSSNIEVFDVFIFAFFSMEMLIKMLALGVYDYEGSYLSNNWNKFDVLIISGEVLNYFLT
SLGIHIQICHALRPMRLIGRVQSLRDLVIILLDTVPMLGNVLILYIFVIHIFGVVGVQLW
AGQLLNRCFLGEDIPKKYNVSLSPYFASKYGEKGPFICSSDGKYGMRRCRDVPPYSQDGE
TCSLTVNEAVPAAAGIRVNGCVNWNLYYNVCRAGDQNPDMGAINFDNIGYALIAIFQVVT
LEGWREIMFYVMDAHSFWSLVFFVLVTIMGSFIMMNVCAVVIATQFSENLGRETGKQPAG
AITQLCNKLTSWLWRILQRYKRYRDKVHPSDSESRSTAIMGQAWMSFKRKLATIVKSKLF
DRVIMFAVFLSILTIAVEHHKQPVELTRMLQISNIIFTFIFVVEMALKQLALAWAYFRDR
NNIFDFIIVIISLWEIIAKADGRLSVLRAFRLLRFVRLVHFLPYLKRQLLVLKRTMEEAG
SLCMLLLFVIFVFSVMGMHLFGCTFSFQAQKGHEIADRMNFDSILWSMVTVFQILTQEDW
NLVLYNAMAATTPWAAFYFVTVIVLGKHVILNVLVGIVVESFQARRSSSSDDDSTSSTPT
SLTPECHSSVTDSSKTNGFSRCILSCFGSRSSIVTNSTDNKEDNRSLNITQRVLRWCRLH
EDWSFYVLSPQNKFRIFCQRVIFHKLFDHVVLLFILLSCVTIAMERPGIHPKSKERWILD
MSRYVFSAVFLVEMLFKVLALGLAIGKDTYCRSSWNVMDGSLVILSLVHIFVSLASTGKD
NWMGILKVLRLLRTLRPLRVIKRAPKLKLAVEALIASVKPIGNIVLICCAFFFFFGILGV
QLFKGKFYYCVGQVITNITSKTDCLSANNRWVRKEYNFDNLPQALMALFVMYSKDGWVNI
MYDGLDAVGVDKPPVRNHNEWMLLFFISFMIMSFFLLDMFIGVMVETFHQCQQEQKRGDE
GAEGGGVLQHHGGEPEQPYYTNYSPIRRAIHTLCTSNFLDLFMSVIIFISVLMMAFEHYN
QPPYIEKLTEYSYYMFTAILIIEVLLKLVAFGIMRFLKISWNLLDVFVVFVSIISIVFNE
MKMADAIPINPSILRVCRVLRLAQVLKAKKIRVLLKTIIKTLSQVGNICLLFMFFFFIYA
ALGVELFGKLECTDDHPCLGLHRHSNFRHFGMALLTLYQVCTGDNWSGIMKDTLRECRPD
GKGCLRYLSWVSPIYFTSFVIMAQFVLINLVVAAIMQALEDSNENKSIAFCLPLEDKDVH
DTELDPACAGESVKPS
NT seq 4191 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaatgtcagtgggaaagcttgcactgtttactccactatatttatatgaca
actttaatcacagagtacctgtgcttgaagtttatcatgactgacttcaagggacaaagg
gagaagcagcaggaggtagcgctcactataccagtccaaggaacttgcaacccaagctcc
atggaggaggggcagctgccctacccgaccctggctcctgtggtatgcttcggcttgaaa
caaaccacaagactccgtaactggtgtctgaaaatgacctgtggcccgtggttggattat
gcgtctatactggtggtgctgatcaactgtgtgactctgggcatgtatgagccctgtgag
gagacaagctccaacatagaggtatttgatgtttttatcttcgcattcttctcaatggaa
atgctcatcaagatgctggctctgggagtctatgactatgaaggaagttaccttagcaac
aactggaacaagtttgatgtcctcatcatctctggagaggtgctgaattactttctaacc
tcccttggcatccacatacaaatctgtcatgcactcaggccaatgcgactcattggcagg
gtccaaagtctgcgagacctggtgattatactcctagacactgtgccgatgcttggaaat
gttctcatcctctacattttcgtcatccacatctttggcgttgtgggagttcagctgtgg
gcgggccagctcctcaaccgctgcttcctcggagaagacatccctaagaagtacaatgtg
tccttaagtccatattttgcgtccaagtatggtgaaaaaggcccgttcatctgttcaagt
gatggcaagtacgggatgcggcgctgccgtgatgtgccaccttacagccaggacggggaa
acctgctcattgacggtgaatgaggcagtccctgctgcggcggggatcagggttaacggc
tgcgtaaactggaacttgtactataatgtctgccgtgccggcgaccaaaaccccgacatg
ggagctatcaattttgataacattggctatgccttgatagccatattccaggttgtcaca
ctggagggatggagggagatcatgttctatgttatggatgctcactccttctggagtttg
gtgttttttgtactcgtcaccattatgggctccttcatcatgatgaacgtgtgtgctgtc
gtcatcgccacgcagttctcggagaacctgggaagggagacagggaagcagcctgctggc
gccatcacacagctctgtaacaagttaacctcctggctgtggaggatccttcaacgatac
aaaagatatcgtgacaaggtgcaccccagtgacagtgagagcaggagtactgccatcatg
ggtcaggcctggatgtcattcaagagaaaacttgcgaccatcgtcaaaagcaaactcttc
gaccgagtgatcatgtttgctgttttcctcagcattctcaccatcgctgtagaacaccat
aaacagcctgtggagttgacacgtatgttgcagatcagtaacatcatcttcacctttata
tttgttgtggagatggccttaaagcagctggcccttgcgtgggcatacttcagggaccga
aacaacatctttgactttatcatcgttatcattagtttgtgggagataatcgccaaagct
gatggcaggctgtcagttctgcgtgcctttcgtctgctgcggtttgtgcggctggttcac
ttcctcccttacctgaagagacaactgctggtgttgaagaggacgatggaggaagcaggc
tcgctctgcatgctactgctgtttgtcattttcgtttttagcgtaatgggtatgcacctg
ttcggttgtacgtttagcttccaggcgcagaagggacacgaaattgctgaccggatgaac
tttgactccatactgtggtccatggtcactgtgttccagattctgactcaggaggactgg
aatctggtgctgtacaacgccatggctgccaccaccccatgggctgctttctactttgtg
actgtcattgtgctaggaaaacatgttattctcaatgtacttgtgggcatagtagttgag
agcttccaggccaggcgctcctcaagctcagatgacgactccaccagctccactccaacc
agcttgactcctgagtgtcactcttcagtgacagatagcagcaagacaaatggtttctca
agatgcattctctcttgctttgggtcaaggagttccattgtgactaactctacagataac
aaagaggacaatagatctttaaacattacccagagagtgctgcgctggtgcaggctccat
gaagactggtcattctacgtgttgtctccacagaacaagttccgtatcttttgccagcgt
gtgatctttcacaagttgtttgaccatgtagttctgcttttcatcctcctgagctgtgtc
accattgctatggagaggcctgggatacaccctaagagcaaggaacgatggatcctggac
atgtcccgttatgtattctctgctgtcttcctggtagagatgctttttaaggttctagct
cttggtttggcgattgggaaggacacctactgtcggtcctcctggaatgtcatggatggc
tccttagtaattctgtctttagtccacatctttgtctctctggccagtacgggcaaagac
aactggatgggtatcctgaaagttttacgcctgctccgcacgcttcgcccactgagggtg
atcaagcgagccccgaaattgaagctggctgtggaagctctgatcgcctcggtcaaaccc
atcgggaacattgttctgatttgctgcgccttcttctttttctttggcatccttggtgtg
cagttgttcaaagggaagttctactactgcgtgggtcaggtcataacaaacataaccagc
aagactgactgtctgtcggccaacaatcgatgggttcggaaggagtacaactttgacaac
ctgcctcaggctctgatggccttgtttgtaatgtactctaaggatggctgggtcaacatc
atgtatgatgggctggatgcagtgggagtcgacaaaccgccagtgaggaaccacaacgaa
tggatgcttctgttcttcatttccttcatgattatgagcttctttctcctcgacatgttt
attggtgtgatggtggagacgttccaccagtgtcagcaggagcagaaaagaggagatgaa
ggagcggagggaggaggagtcctgcaacaccatggcggagaacctgagcagccatattac
accaactactcccccatacgtcgggcaatccataccctgtgtaccagcaacttcctggac
ctcttcatgtctgtcataattttcatcagcgtcttgatgatggctttcgaacattataat
caacctccgtacatagagaagctcacagagtactcctactacatgttcaccgccatcttg
atcatcgaagtccttctaaagcttgtggcctttggcataatgaggttcctaaaaatcagt
tggaatctgctggacgtctttgtagtctttgtttccatcataagtatcgttttcaacgag
atgaaaatggcagatgcaattcccatcaatcccagcatcctgagagtctgtagagtactc
agactagcacaagtgctgaaggccaaaaagataagagttctcctgaaaaccatcatcaag
acactatcacaggttggaaatatttgtctgctcttcatgttcttctttttcatctatgct
gcgctgggagtggagctgtttggcaagctagagtgcacagacgatcacccgtgcctgggt
ttacatcgacactccaacttcaggcacttcgggatggcactgctcacactctaccaagtg
tgcaccggagacaactggagcgggattatgaaagacacattgagggagtgtcgtcccgac
ggtaaaggctgtttgagatacctgtcctgggtctctccaatctacttcactagctttgtg
atcatggctcagtttgtgttgataaacctggtggtggcagcgatcatgcaagctctggag
gacagcaacgagaacaagtctattgccttctgtctccccctggaggacaaagatgtgcat
gacactgagctggacccagcatgtgcaggggaaagcgtcaagccaagttga

DBGET integrated database retrieval system