KEGG   Lates calcarifer (barramundi perch): 108893526Help
Entry
108893526         CDS       T04895                                 

Gene name
b4galt4
Definition
(RefSeq) beta-1,4-galactosyltransferase 4
  KO
K07969  beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.275 2.4.1.-]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00533  Glycosaminoglycan biosynthesis - keratan sulfate
lcf00601  Glycosphingolipid biosynthesis - lacto and neolacto series
lcf01100  Metabolic pathways
Module
lcf_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    108893526 (b4galt4)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    108893526 (b4galt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lcf01003]
    108893526 (b4galt4)
Enzymes [BR:lcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     108893526 (b4galt4)
    2.4.1.275  neolactotriaosylceramide beta-1,4-galactosyltransferase
     108893526 (b4galt4)
    2.4.1.-  
     108893526 (b4galt4)
Glycosyltransferases [BR:lcf01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   108893526 (b4galt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Internalin_N
Motif
Other DBs
NCBI-GeneID: 108893526
NCBI-ProteinID: XP_018547150
Position
Unknown
AA seq 348 aa AA seqDB search
MGLCSPVCKILRRGKYFVLLFLSLSLLAWIATFSGETVKSAQVSPSTTQTLVKGDSLRDK
LTSWTTAPDRLNTPPAKGECPEKSPLLQGAVKLSFESSLKLKDVQSDNKGVTEGEYEPPD
CRARQSVAILIPHRSRERHLLYLLHHLHPFLQRQQLHYAIYVIQQAGDATFNRAKLLNIG
YLEALKDYSWECFIFHDVDLVPENDHNSYVCDKQPKHLVVGRNATGYKLRYKGYFGGVTA
MSKEQFLQVNGFSNIYWGWGGEDDDLRIRVELQKMKIVRPPADVARYTMVFHKRDSGNEI
NKDRMRLLGRTSQVWRKDGLNSCSYKTLSVERLPLYVNITVDIGKPQS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgggcctctgttcgcctgtgtgcaagattttgcgcagggggaaatattttgtactgctc
ttcctctcactctcgctgctggcatggatcgcaactttttcaggcgaaacagtgaaatcc
gcccaggtttcccccagtacaacacaaactcttgtgaaaggagacagtctaagggataaa
ctcacctcttggacaacagcacctgatcgcttaaatactccaccagcaaaaggcgagtgc
cctgagaagtcaccattactacagggagctgtgaagctgtccttcgagtcctctctgaaa
ctgaaggatgtgcagagtgacaacaaaggagtgactgagggcgagtatgagcccccagac
tgtagagcgaggcagagtgtggcaatcctcatccctcatcgcagccgagagagacacctc
ctctacctcctgcaccacctgcacccctttctgcagaggcagcagctacattacgccatt
tatgtcatccagcaggctggtgatgcaacctttaaccgtgccaagttactgaatattgga
tatttggaggcactgaaggactacagttgggagtgcttcatctttcatgatgttgatcta
gttcctgagaatgatcacaattcatatgtctgtgacaagcagcccaaacacttggtagtt
ggccggaatgccacaggatacaagctgcgttacaaaggatactttggaggagtcacggca
atgagcaaagagcagtttcttcaagtgaacggattctcaaacatttactggggttggggg
ggagaggacgatgaccttcgcatcagggttgagctgcagaaaatgaagattgtgcggcca
cctgctgatgtagctcgctataccatggtattccacaaacgggacagtggcaatgaaata
aataaggataggatgaggttattgggacgaacatcacaggtatggagaaaggatggactc
aacagctgttcatataagacattgtcagtggagaggctgcctctttatgtgaacattact
gtggacattggtaagccacagagttga

DBGET integrated database retrieval system