KEGG   Lates calcarifer (barramundi perch): 108893578Help
Entry
108893578         CDS       T04895                                 

Definition
(RefSeq) complement factor B-like
  KO
K01335  complement factor B [EC:3.4.21.47]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lcf01002]
    108893578
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     108893578
Peptidases and inhibitors [BR:lcf01002]
 Serine peptidases
  Family S1: chymotrypsin family
   108893578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Sushi VWA Trypsin_2 VWA_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 108893578
NCBI-ProteinID: XP_018547243
Position
Unknown
AA seq 768 aa AA seqDB search
MSSLLFNMGFSVNWSWFAALSCLLSMGGEVWCDCTDTGMQMEGGSYTLTKQLQKGSMLVY
QCPSGYYPYPTLVRLCQLDNTWRPAPKRFSPQRCKRVECPDPNVLEYGNVSPPQEKYYVD
NETTYECYSGYTMRGSSTRVCLPNGKWSGSTPICSRDSGDHCADPGIPAGASRTGNIFGI
DDRVRYTCNGNLFLVGSSERVCQENGQWTGKEPACYYKHTYDTPLEVSEAFGSSIKDTLT
TLESTDDTQEGRKIRIPKNGTLNIYIAVDISESIEKEHFINARDAVTKLITKISSFSVTP
NYEILFFSADIIGVVNILDFLDGKAILSNVKNTLEKFEVGDNNTAGTDLNAVFEHFLERM
AIIKQRAGPEGFKEHRHVLIVFTDGAYNMGGSPEPTVKKIKNMVYMNHTTERETQSREEF
LDIYVFAIGAEIYDDDLQPLTAGIGKHYFRMKDIENLQETFDEIIDEEEVKGLCGLHKEY
DTYDKDSKRKMYPWWAYIIVQNERPKRCLGSLVSPKFILTAAHCFTFGDLPEHVTVEIND
EQGRVKKVKDFKLHPNYNVNAKAELGVKEFYDYDVALIQLEKDVRISSSVRPICIPCTQE
TSDALQLVGESTCKQQEQLLLKNHLEKLNFLTKIGDSVDEKEVHAKLGDNRDDCIRHALQ
APGITTDNPKVPVTDNFMCTGGLTPFRDHIACTGDSGGAVFKNYQHRTIQVGMVSWGTKN
LCKAGGMVESVESSRDFHMNLFRVVPFLKSVLGNDTQDDYAPLQFLEN
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtttactgttcaacatgggattttctgtcaactggagctggtttgctgccttg
tcatgtctgctctccatgggaggtgaagtctggtgcgattgcacagacacgggtatgcag
atggagggaggtagttacacactaaccaagcagctgcagaaaggcagcatgttggtctac
cagtgtccttcaggctactacccgtaccccactttggtccgtctgtgccagcttgataac
acctggagaccagcacccaaaagattttcacctcagagatgcaagcgtgttgaatgccca
gaccccaatgtgctggagtacggaaatgtgtccccccctcaggagaagtactacgtggac
aatgagaccacgtatgagtgttactctggatatacaatgagaggctcaagcactcgtgtt
tgtttgccaaacggaaagtggagtggctctactcccatctgtagccgtgactcaggagat
cattgtgctgatcctggtatcccagctggtgcctcaagaacagggaacatatttggaatt
gatgacagagtgagatacacctgcaatggcaacctgtttttggtggggtcaagtgaacga
gtgtgtcaggagaacggccagtggaccggcaaagagccagcatgttactacaaacacacc
tatgacactccattggaggtttcagaggcatttggcagttcaatcaaagacactctcacc
actttagagtcaactgatgacacacaggaggggagaaaaatcagaattcctaaaaatggg
acacttaacatctatattgctgtggatatttctgagagcatagaaaaggaacacttcatt
aatgcaagagacgctgtcacaaaacttattacaaagatttcatccttcagtgtgactcca
aactatgaaatcctttttttctctgccgacataattggagttgtcaacattcttgatttt
ttggatggcaaagcaatactaagtaatgttaagaatacactggaaaaatttgaagtgggc
gacaacaacacagcaggaacagatctgaatgctgtctttgagcacttcttggaacgaatg
gctattataaagcaacgagctggaccagagggttttaaggaacatcgtcacgtcctcatc
gtttttacagacggtgcttataacatgggcgggtcacctgaacccaccgtgaaaaaaata
aagaacatggtatacatgaaccatacaactgaaagagagactcagtcaagagaagaattt
cttgacatttatgtttttgccattggagctgagatctatgatgacgacctgcagccccta
acagcagggatagggaagcattacttcagaatgaaggacattgaaaatctgcaagagacc
tttgacgaaataattgatgaagaagaagttaagggtctatgtggtcttcacaaggaatat
gacacgtatgacaaagacagcaagaggaaaatgtatccatggtgggcatacattattgtc
cagaatgaaagaccaaagagatgccttggctctctggtgagcccgaagttcatcttgact
gctgctcactgcttcacatttggtgatttacctgagcacgtcacagttgagattaatgac
gaacagggcagagtgaaaaaagtaaaagatttcaaattacacccaaactacaacgttaat
gctaaagcggagctcggtgtgaaggagttctatgactatgatgtggctctcatccaactg
gagaaagatgttcgaatctccagctctgttaggcctatttgcataccctgcacccaggag
accagtgatgctctacaactggttggtgaatccacctgcaagcaacaagagcagcttctg
ttaaagaatcatcttgaaaaactaaatttcctgaccaagataggagactctgtggatgaa
aaagaagttcacgccaaacttggtgataatagagatgattgcatcagacatgcactacag
gcaccagggataacgacagataatccaaaggttcctgtgacagataacttcatgtgcact
ggcggtctgactccttttagggatcatatagcatgtacaggcgactctggaggtgctgtg
tttaagaactatcagcatcgcacaatacaggttggcatggtcagctggggaaccaagaat
ctgtgcaaggcgggaggtatggttgagtcggttgagtcctccagagatttccatatgaat
cttttcagagttgtcccctttctcaaatctgtcctcggaaacgacacccaggacgactat
gcaccgcttcagtttttggagaactga

DBGET integrated database retrieval system