KEGG   Lates calcarifer (barramundi perch): 108895408
Entry
108895408         CDS       T04895                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04080  Neuroactive ligand-receptor interaction
lcf04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108895408 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108895408 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 108895408
NCBI-ProteinID: XP_018549735
Position
Unknown
AA seq 77 aa
MNVKILTLVIVLLVSLLCSASAGPMASMEHGRELEEASTVRKMVQQNPARGGQTHRPAGW
KRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctggtcccatggcctccatggagcatggcagagagctggaagaggcctccacagtg
agaaaaatggtccagcaaaaccctgcgaggggtggtcagacccacagaccagctggctgg
aagaggagacgcccacggccccgtctttcccacaaggggcccatgccgttttag

DBGET integrated database retrieval system