KEGG   Lates calcarifer (barramundi perch): 108896893Help
Entry
108896893         CDS       T04895                                 

Gene name
mgat2
Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00510  N-Glycan biosynthesis
lcf01100  Metabolic pathways
Module
lcf_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    108896893 (mgat2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lcf01003]
    108896893 (mgat2)
Enzymes [BR:lcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     108896893 (mgat2)
Glycosyltransferases [BR:lcf01003]
 Glycan extension
  N-Glycan
   108896893 (mgat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2 FeoB_associated
Motif
Other DBs
NCBI-GeneID: 108896893
NCBI-ProteinID: XP_018551693
Position
Unknown
AA seq 468 aa AA seqDB search
MRFRIYKRKVVILTLVVVICGLAFWSSGRQKKNDSGSFPKEVETVRRSSSISSSSSSINN
HIQVQATPAVSRAPVPPPLIQANDTHPEKAKDKEKIPKPEVDNTTLVYRGIVFQLNFDQT
IRNEEKFKTSRQKDDLVVVVQVHNRPDYLKLLVDSLRKVRGVESILLIFSHDYWSPEINK
VVASVDFCQVLQIFFPFSIQLYPQEFPGNDPRDCPRDIPKKDALKLGCINAEYPDSFGHY
REAKFSQTKHHWWWKLHFVWDRVRVLKDHKGLVLLIEEDHYLSPDFIHLLKLMSTLKREQ
CTDCDILSLGSYSHIGYSSKANKVEVKAWKSTEHNMGMALSRETYQKLIQCTDTFCTYDD
YNWDWSLQHLTVSCLPSYWKVMVSEAPRIFHAGDCGMHHKKASCMPISQKTKIENILQSS
GNQLFPKNLLIAKRLPANGAGGVAPHVKNGGWGDIRDHELCKSYVRLQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagattccgaatctacaagaggaaggtggtgatactgactctggtggttgtcatctgt
ggcctagctttctggagcagcggaaggcagaaaaagaacgacagtggttcgttccccaag
gaagtggagacagtgaggagaagcagcagcattagcagcagcagtagcagcatcaacaat
cacatccaggtgcaagccacacctgcagtcagccgggcacctgttccacctcctcttata
caagcaaatgacacacatccagaaaaagcaaaggataaagagaagataccaaaaccagag
gtagataacaccactttagtctaccgtggcattgtcttccagctaaattttgaccagaca
ataagaaatgaggagaagtttaagacctcgcgacagaaagacgatctggttgtggtagtt
caggtccataaccgaccagactaccttaagctattagtggacagtttgcggaaggtcaga
ggtgtggagagcatactgctgatattcagccatgactactggtcccctgagataaataaa
gtggtggcctctgtcgacttctgtcaagtccttcagatttttttccccttcagcattcag
ctgtacccccaggagttccctggaaatgaccccagggactgccccagagacattcctaaa
aaagatgccttaaagctgggatgcatcaacgcagaataccctgactcatttggccactac
cgcgaggccaagttctctcagaccaagcaccactggtggtggaagctgcactttgtgtgg
gacagggtccgggttctgaaggaccacaagggtctggtcctgctgatcgaggaggaccac
tacttgtctccagattttatccatctcttaaagctgatgtcaactctcaaaagggagcag
tgcacagactgtgacatcctctcactggggagctatagccacattggctactccagcaaa
gcaaataaggtagaggtgaaggcctggaagtctactgagcacaacatggggatggctctg
agtagagagacgtaccagaagcttattcagtgcaccgacacgttctgcacttacgacgac
tacaactgggactggtccttacaacacctgactgtgtcctgcctgccctcctactggaag
gtcatggtgagtgaggcgccacggattttccatgccggagactgtggcatgcaccacaag
aaggcctcttgcatgcccatcagccagaaaaccaagatagagaacatcttacaaagcagc
gggaaccagctgttcccgaagaacctcctgatagccaagagactgccagccaacggggcc
ggaggggtggccccacatgtgaaaaatgggggctggggagatatcagggaccatgaactc
tgcaagagttatgttcgattacagtga

DBGET integrated database retrieval system