KEGG   Lates calcarifer (barramundi perch): 108896969Help
Entry
108896969         CDS       T04895                                 

Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase-like
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00513  Various types of N-glycan biosynthesis
lcf00514  Other types of O-glycan biosynthesis
lcf00515  Mannose type O-glycan biosynthesis
lcf00533  Glycosaminoglycan biosynthesis - keratan sulfate
lcf00601  Glycosphingolipid biosynthesis - lacto and neolacto series
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    108896969
   00515 Mannose type O-glycan biosynthesis
    108896969
   00514 Other types of O-glycan biosynthesis
    108896969
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    108896969
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    108896969
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lcf01003]
    108896969
Enzymes [BR:lcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     108896969
Glycosyltransferases [BR:lcf01003]
 Terminal extension
  Sialyltransferase
   108896969
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 108896969
NCBI-ProteinID: XP_018551862
Position
Unknown
AA seq 95 aa AA seqDB search
MRMKPSRNLLLGLCSMLALGFLYYSSGRISLQGWGRKSLYDKQGFLLKLDGGLPLELIYK
YGNLSEGACKPGFAAAKMTAIYPKSQKPEGLASCV
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgaaacccagtcgcaacctcctcctgggcctgtgctccatgctggccctggga
ttcctctactactcgtcagggaggatcagcttacaaggctggggccgcaaatcattgtat
gacaagcaaggattccttctgaagctggatggtggtctgcctttggagctgatctacaag
tatggcaatctcagcgagggggcctgtaagcctggttttgcagcagccaagatgactgcc
atttatccaaagagtcagaagccagaaggacttgcctcttgtgtgtag

DBGET integrated database retrieval system