KEGG   Lates calcarifer (barramundi perch): 108897184Help
Entry
108897184         CDS       T04895                                 

Gene name
fkbp7
Definition
(RefSeq) LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase FKBP7
  KO
K09573  FK506-binding protein 7 [EC:5.2.1.8]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lcf03110]
    108897184 (fkbp7)
Enzymes [BR:lcf01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     108897184 (fkbp7)
Chaperones and folding catalysts [BR:lcf03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    108897184 (fkbp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 RSB_motif
Motif
Other DBs
NCBI-GeneID: 108897184
NCBI-ProteinID: XP_018552182
Position
Unknown
AA seq 219 aa AA seqDB search
MMWKLVSCALCFFVSAQLSLFSSWATADELNSEIKIEVLFKPEECTQKSKRGDLMNVHYD
GFLAKDGSQFYCSRSDKAGHPQWLVLGIGQVIKGLDIGMMDMCPGEKRKITVPSGLAFGE
NGKGPVPPNATVIFEVEVYAVSRGPRSMEAFIEMDLDKDKSLTKAEVREYLQQDYEKRGK
KHDEPFYQKIMDDIFRKSDHDRDGLISAKEYNIYQHDEL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggaagttagtaagctgcgcactgtgcttctttgtctctgcacagctcagttta
ttttcctcttgggccacagcagatgagctgaacagcgagatcaagatcgaggttttgttt
aagcccgaagagtgcactcaaaagagtaaaagaggagatctgatgaacgttcattacgat
gggttcctggccaaagatggttcccagttctactgcagtcgatcggacaaggctgggcac
cctcagtggctcgtgctgggcatcggacaagtcatcaagggcttggatattgggatgatg
gatatgtgtcctggagagaaacgaaaaataactgttccttctggcctggcatttggagaa
aatggcaaaggtccagtgccgcccaatgctacagtgatctttgaggtggaggtgtatgca
gtgtccaggggaccacgcagtatggaagctttcatagagatggaccttgacaaagacaaa
agtctcacaaaggctgaggtaagagaatatttacaacaggactatgaaaaaagagggaag
aaacatgatgagccattctatcagaagatcatggatgatatatttcgcaagagtgaccac
gacagagacggactgatcagcgcaaaggagtataatatttatcaacatgatgagctctag

DBGET integrated database retrieval system