KEGG   Lates calcarifer (barramundi perch): 108897275Help
Entry
108897275         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00010  Glycolysis / Gluconeogenesis
lcf00562  Inositol phosphate metabolism
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108897275
   00562 Inositol phosphate metabolism
    108897275
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108897275
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108897275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Exostosin
Motif
Other DBs
NCBI-GeneID: 108897275
NCBI-ProteinID: XP_018552333
Position
Unknown
AA seq 472 aa AA seqDB search
MVNESFWVDHDDFSLEIHNLSYSFIILCCLRIYVTLEDDPEIPAIVKYFNTKGRYEEVNP
FLIEDILAVNRSILQFPAAQCQEIHLTAIIRHGTRYPTSKNIKEMQQLYNIVLHNASGEE
SWLREIQTQWTMWYTEDMDGRLVQKGVNDLKHLAVRLSKLFPSLISEEKLRGGLIQFITS
SKHRCINSTLAFKSGLQKLWDIKDQEFDHTVNDALMRFFDKCTRFVQKVNNNPSAVIEVD
NFKQGPEMRRVQEKISNRLRVPYSLITHDMAEAAFYLCAYEFAIKTVHSPWCRLFDEVDA
QVMEYASDLREFWKRGYGHDINRKASCILFHDVFSRLHKAASENKSGQQVTKPVTAQVGH
ADTLLPLLTLLGFFKDSQALNSTNYAAQTNRTFRTSHMLPYAANLILVLYDCGGGDLRLQ
PLLNEKPVTFPGLGDQQSSMPLYQNVREHYRELLQGCDFENECQLFKHPEEV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggttaacgaatccttttgggtggatcatgatgacttttctttggaaattcacaatctc
tcttattcctttatcatcttgtgctgtttacgcatttatgtgacacttgaggatgatcca
gaaataccagccatcgtcaaatatttcaacacaaaagggaggtatgaggaagtgaatccg
ttcctcatagaggacatacttgctgtgaacagatctattttacaatttccagctgcacaa
tgtcaagaaatacatctgaccgcaataataagacatggcacaagatacccgacaagcaaa
aacatcaaggagatgcagcagctctacaacatcgtcctgcataatgcctcaggtgaagag
agctggctgcgtgaaatccagacccagtggacaatgtggtacactgaggacatggatggc
cgactcgtccagaaaggtgtgaacgatctgaagcatctggccgtcaggctgtcaaagctg
ttcccctcactgatttcagaagagaaacttcgaggtggactcatccagttcataaccagc
tcaaagcacaggtgtatcaacagcacgttggcctttaagtcaggattgcagaagctgtgg
gatattaaagatcaggaatttgaccacacagtgaatgatgctctgatgagattttttgac
aagtgcaccaggtttgtgcagaaagtcaataacaacccctcagcagtgatagaggtcgac
aacttcaagcagggaccggagatgaggagggtccaggagaagatctcaaaccgtcttaga
gtcccatacagcctcatcacacacgatatggctgaagctgcattttacttgtgtgcttat
gaatttgccatcaagacggtgcactccccctggtgtcgactcttcgatgaggttgatgca
caggttatggagtatgcaagtgacctgagggaattctggaaaagaggctatggtcatgat
attaacagaaaggcaagctgcattctctttcacgatgtgtttagccgattacacaaggct
gccagcgagaacaaatctggccagcaggtgaccaaacccgtgacagcccaggtcggtcat
gcagacaccctcctgccactgcttaccctgctgggcttcttcaaggatagccaagccttg
aattccaccaactacgccgcacagaccaaccgaaccttccgaaccagccacatgttgccc
tatgcagctaatttaatcctggtgctgtacgactgtgggggaggcgacctgagactgcag
ccgctgctcaacgagaagcctgtgactttcccaggtttaggtgaccagcagtcctccatg
ccgctctatcaaaacgtcagagagcactatcgggaactgctccaaggttgtgactttgag
aatgagtgtcagctgttcaagcatcctgaagaggtttag

DBGET integrated database retrieval system