KEGG   Lates calcarifer (barramundi perch): 108898270
Entry
108898270         CDS       T04895                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lcf03000]
    108898270 (ahrr)
Transcription factors [BR:lcf03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    108898270 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 108898270
NCBI-ProteinID: XP_018553725
UniProt: A0A4W6FZ93
Position
Unknown
AA seq 696 aa
MIPPGDCMYAGRKRRKPIQKQKPSSANEKTNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQASQEKTSRKHIISPTSSNPEPRKESLPLGTAVNESSLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMC
PPQHQGTSAHQDNQLAAGTGEDFAVSSQFHSLEAGGIPPELSCFLNRCFIARVRCLLDST
SGFLTMQFQGRLKFLHGQKKKTASGALMPPQLALFCIAVPLLLPSITEMKMKNMLMRGKN
KGGGGGGIISALEHGERGEHLRRHSFSGGMGDITDPLLLSCPTPGGTQRGHHTPWTPLSK
DNLKYHPDGYYNQEEPLNYCKSSVASHKGLSPGLGGGWPLRPNSGPLRAGQGVGYIPSNR
LNKAGQYGKPYRLSPSCHNTRGGEVFVSKLYGNIQIPSDPDAYCVDLVKSENGYGECYDS
HLMPEMAPIKVEHDSDSENGCDAYGRSWACRDPGAVDRRYGNGIYDQSSGLQLKSEADFY
DPQYSPCQRGKAGISPPYNNGNYHNYAVNNSGNATARLLKCDKDLGNNNDNNQFSPQRLS
HSDSLCSNQSVNLMDSHVYPQDPHKAYMHPDYNKHGTYEFKGHSLIHSIKREPMDSPPWS
ESGHDINQSMMVGPRNVMPCAMSTGHHKSSPYIYMP
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgatccctccgggagactgcatgtatgcgggcagaaagaggaggaagcccatccaaaaa
cagaagccgtcctctgccaatgagaaaaccaacccgtccaagcggcaccgggacagactg
aacgctgagctggaccggctggccagcctgctgccgttccccccggatgtcatctccaag
ctggacaagctgtccgtgctgcgccttgcagtctcctacctccgcgtcaaaagcttcttc
caagcgagccaagagaagacctccaggaagcacatcatcagccccacatcctctaaccct
gaacccaggaaagagagtcttccactgggcaccgctgtcaatgaaagcagcctcctgctg
gaatctctgacaggctttgccctggtggtgagcagtgatgggatggtcttttatgcctcc
tcaaccattgtggattatctgggatttcatcagactgacgtgatgcaccagaatgtgttc
gattacatccacatagacgaccgtcaggagttcagacgccagctccactgggccatgtgt
cctccacagcaccaggggacgtcggctcaccaggataaccaactagctgcagggaccggt
gaagactttgcagtcagcagccagtttcactctctggaggcggggggaattcctcctgag
ctctcctgttttctcaacagatgtttcatagccagagtccgatgcctgttggacagcacc
tctggattcttgacgatgcagttccagggtcgactgaagttcctccacgggcagaagaag
aagacggcctccggggctctgatgcctccccagctggctctgttctgcatagctgtaccc
ctcctactgccctccatcactgagatgaaaatgaagaacatgttaatgcgggggaagaac
aagggaggaggaggaggagggattatctctgcgctggagcatggtgagcgaggggaacac
ctccggagacactcgttcagtgggggaatgggtgacattacagaccctctcctcctctcg
tgtcccactcccggcggtacccagcggggtcaccacactccctggaccccgctttccaaa
gacaacctcaagtaccaccctgatggttactacaaccaggaggagcccctcaactactgc
aagtcctccgtggcctcccataaaggtctcagcccaggcctgggtggcggctggcctctg
aggccaaactcaggcccccttagagcgggacagggtgttggctacatcccctccaaccgc
ttgaacaaggccggtcagtacgggaagccgtaccgcctttccccgagctgtcacaacacc
agaggcggtgaggtttttgtgtcgaagctctacgggaacatccagattccctcagaccca
gacgcctactgcgtggacctggtgaagagcgagaacggttatggagaatgctacgacagc
cacctgatgccagagatggcccccatcaaggtagagcacgactcagactctgaaaatggc
tgcgacgcctacggacgatcctgggcttgccgcgacccgggggctgttgaccgtcgctat
ggtaacgggatatacgaccagagctcaggcctgcaactcaaatcagaggcagatttctat
gatccgcagtactcgccctgtcagcgagggaaagcaggcatcagcccgccgtacaacaac
ggaaactatcacaactatgcagtcaacaatagcggaaacgccaccgcacgtctgttgaag
tgcgacaaagacttgggaaacaacaatgacaacaaccagttcagtcctcagagactctct
cactcagactctctatgcagcaaccaatcagtcaacctcatggactcacacgtctaccca
caggacccacacaaggcctacatgcacccggactacaacaagcatggcacttacgagttc
aaaggtcacagcctgatccattcgatcaagcgtgagcccatggactccccaccgtggtct
gagagcggccatgacataaaccagtccatgatggttggtccaaggaacgttatgccgtgt
gcgatgagcacaggtcaccacaagtccagtccttacatttatatgccgtaa

DBGET integrated database retrieval system