KEGG   Lates calcarifer (barramundi perch): 108898488Help
Entry
108898488         CDS       T04895                                 

Definition
(RefSeq) cytosolic phospholipase A2 gamma-like isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00564  Glycerophospholipid metabolism
lcf00565  Ether lipid metabolism
lcf00590  Arachidonic acid metabolism
lcf00591  Linoleic acid metabolism
lcf00592  alpha-Linolenic acid metabolism
lcf01100  Metabolic pathways
lcf04010  MAPK signaling pathway
lcf04217  Necroptosis
lcf04270  Vascular smooth muscle contraction
lcf04370  VEGF signaling pathway
lcf04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108898488
   00565 Ether lipid metabolism
    108898488
   00590 Arachidonic acid metabolism
    108898488
   00591 Linoleic acid metabolism
    108898488
   00592 alpha-Linolenic acid metabolism
    108898488
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108898488
   04370 VEGF signaling pathway
    108898488
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108898488
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108898488
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108898488
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     108898488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 108898488
NCBI-ProteinID: XP_018553882
UniProt: A0A4W6E1Y6
Position
Unknown
AA seq 584 aa AA seqDB search
MQTGNAGLLVLLIRLCLLTSGTLTKAVDNTEGNEAASEKLIRHSHSLCAGEQEYVDRRKI
VVLESLNSLGINCTADSIPHIALLASGGGQRAAVGLVGFLYQMEKEGLLDTLLYLGGVSG
STWSMSSLYSDPQWSTNMDRAVSRLSGPGVELEQVLAWLGDRAKEEHFSLADIWAVLTSA
VIMKQMDLRHLSDEASRNATNPYPIYSAIEKKCFSDGPIEGKWFEVSPHEAGFTEMGVFV
ETSLLGSKFQSGELLEVTPEMDMVRLQGILGCALAHEEVIREFIPPWLNVPGQVDSAAEE
YLRIYRTIDKLVVLTRSTINDPTALSELNKLQKTLTDKVTLNESALLESKSLEERKSIFQ
QWSLELLAAVETWSQSLEDGAFKTHVSLLTKQVLPLILKWEWGTTKNFLYQYQGLTIPPC
LQSKEKLHLVDAGLLINVAYPPFLGDKRDIDLMIAPEFSAGNMFETLTLARDYATEVRKP
FPEIDNKILEERDWPKDCYVFEGKEKEPTIIYMPLFNRQNCKDAEEFKARMEEFSTFQYA
FSQEKIEFMLETVKANMKNNKDTLVREINKAALRRQNKRKSLQH
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgcagactggaaatgcaggtttgttagtcttgttgattcgcctttgccttttgacttca
ggcactctgacaaaagcagtggacaacacagagggaaatgaggcagcttcagagaaactc
atccgtcactcccactctctgtgtgctggtgaacaagagtatgttgacaggaggaaaatt
gtagttctggagtcactcaacagcctgggaatcaactgtactgctgattctattccccac
attgctcttctggcgtcaggtgggggtcagagggcagctgtgggtctggtgggttttctc
tatcagatggaaaaggaaggtctgctggacactctgctctacctgggaggagtttctggg
tcaacatggtccatgtcctccctgtacagtgacccgcagtggagcaccaacatggacaga
gcagtgtcaaggttatcaggtcctggggtcgagctggagcaggttctggcctggttgggt
gacagggcaaaagaggagcacttctctctcgctgatatctgggctgttctaacttctgct
gtgatcatgaaacagatggacctgcggcatctttcagatgaggccagtaggaatgccaca
aacccttaccccatttatagcgccatcgagaagaaatgcttttcagacgggcctatagaa
gggaaatggtttgaggtgagccctcatgaagctggattcacagagatgggtgtctttgtt
gaaacatctcttttgggcagcaaattccaaagtggagagctgctagaggtgaccccagag
atggacatggtaagactacaaggtattctaggttgtgctttggctcatgaggaggttatc
agagaattcatccctccctggctgaatgtgcctgggcaagtagacagtgctgctgaggaa
tacctgcgcatatacagaaccattgataaactggtggtcctgaccagaagtaccattaat
gatcctactgctctgtctgaactgaataaactgcagaaaacactaacagacaaggtaact
ctgaatgagtctgccttgcttgagtccaagagtttggaggaaagaaaaagtatttttcag
cagtggagtctggagctgctggcagcagtagagacctggagccaaagtctggaggatgga
gctttcaaaacacatgtgtctctgcttactaagcaagttcttcccctgattttgaaatgg
gagtggggaactacaaaaaacttcctgtaccaatatcaaggtctcaccattccaccttgc
cttcaatctaaagaaaaattacatctggtggatgctgggctgttgattaatgtagcgtac
cctccatttctgggggacaagagagacattgacctcatgattgcaccagagttcagcgct
ggaaacatgtttgagactctgactcttgccagagactatgcaactgaagtgaggaagcct
ttcccagagatagacaacaaaatcctggaggagagagactggccaaaggactgctacgtg
ttcgagggaaaagagaaggagcccacgatcatttacatgccactcttcaacagacagaac
tgcaaagatgcagaggagttcaaagcaaggatggaggagttctccaccttccagtatgcc
ttcagccaggagaagattgagtttatgttagagacggtgaaagctaacatgaagaacaac
aaggatactctggtgagagagataaataaggccgctctacgcagacagaataagaggaag
tcattgcaacactaa

DBGET integrated database retrieval system