KEGG   Lates calcarifer (barramundi perch): 108898665Help
Entry
108898665         CDS       T04895                                 

Definition
(RefSeq) melanin-concentrating hormone receptor 1-like
  KO
K04320  melanin-concentrating hormone receptor 1
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108898665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lcf04030]
    108898665
G protein-coupled receptors [BR:lcf04030]
 Rhodopsin family
  Peptide
   Melanin-concentrating hormone (MCH)
    108898665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 108898665
NCBI-ProteinID: XP_018554146
Position
Unknown
AA seq 337 aa AA seqDB search
MCSCPASFAVICFFGIIGNCIVIYTIVKKTKLCSQQTVPDIFIFSLSIADLLFLLGMPFL
IHQLVGNGSWCFGGTMCTVITALDSNSQTVSTYILTVMTLDRYLATVHPIRFKHVRTPFM
AGAAVALVWVFSLVSITPVWMYTGLMRLKDGSVGCALLLPNPATDTYWFTLYQFFLAFAL
PLVVICGVFFKILQNMSATVAPLPQRSLRVRTRKVTCMAVAICLAFFICWAPYYILQLAH
LGVQRPTFAFLYAYNIAISLGYANSCINPFIYIILSETFKRRFIVAIRPSHRVFRVAPAL
ADGSMNLRMAVDSSHPSHLQSSRELLQNILPVTVAVH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcatgcccagcatcatttgctgttatttgtttcttcggaatcattggaaactgt
atagtcatctacaccattgtgaagaaaaccaagctctgctcccagcaaacggtgccagac
atatttatcttcagcttgtccatcgcagacctcctctttctccttggcatgccttttctc
attcaccagctggtgggtaatggctcctggtgctttggtggtaccatgtgcactgtcatt
acagcgctcgactccaacagccagactgtcagcacatacatcctgactgtaatgactctg
gatcgttatctggccactgtgcatcccatccgcttcaaacatgtccgaacacccttcatg
gccggggcggcagtagcactggtgtgggtgttttctttggtctccatcaccccagtgtgg
atgtacacaggactcatgcgtctcaaggatggctccgttggctgcgccctcctgctgccc
aaccctgccacagatacatactggttcaccctctaccagttcttcttggcctttgctctg
cctttggtggtcatctgtggggtcttcttcaaaattctccaaaacatgtcagctacagtt
gctccactgccccagcgcagcctcagggtgcggacaagaaaggtgacctgtatggcagtg
gccatttgcctggcattcttcatttgctgggccccctattacattctgcagctggcccac
ctgggagtgcaacggcccacctttgctttcctgtatgcctacaacatcgccatcagcctg
ggctatgccaacagctgcatcaacccatttatctacattattttaagtgaaacatttaag
aggcggttcatcgtagctatccggccgtctcacagggttttcagagttgcccccgctctg
gctgatggcagcatgaatctgaggatggcagtggacagctctcacccctctcacttgcag
tcatcgagggaactgcttcaaaacattctgcctgtcactgtggctgtgcactga

DBGET integrated database retrieval system