KEGG   Lates calcarifer (barramundi perch): 108901283Help
Entry
108901283         CDS       T04895                                 

Gene name
phf11
Definition
(RefSeq) PHD finger protein 11 isoform X1
  KO
K23310  PHD finger protein 6
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lcf03000]
    108901283 (phf11)
   03009 Ribosome biogenesis [BR:lcf03009]
    108901283 (phf11)
   03036 Chromosome and associated proteins [BR:lcf03036]
    108901283 (phf11)
Transcription factors [BR:lcf03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    108901283 (phf11)
Ribosome biogenesis [BR:lcf03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   108901283 (phf11)
Chromosome and associated proteins [BR:lcf03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    108901283 (phf11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2 DUF2652
Motif
Other DBs
NCBI-GeneID: 108901283
NCBI-ProteinID: XP_018558244
Position
Unknown
AA seq 529 aa AA seqDB search
MNHRPKVCCVLCQRSEETEITGALSTKDEVTAHQNCLLFSSGIYCQNSPEFDDLFGFSVE
DVMKEVKRGGKLTCNKCKRKGATAGCEVGRCKKSYHYPCAIQEGAKAIEEPGEGKYELLC
FKHYQQQQPRDSDSVNGLKAETSKNHNGAGSSKVYCLACENTEGKISLEYLSNGVIMLYC
DKHTPSSYKRNASGDSTVSGLPVCSSDSNSSSSTTRLSKRRLNFSDIQEETPSKRKRRII
DDSSDSDENVPNIECAPLESDFEENANSVPEHQFSRKGSGRPTASTSDESRGSNKDEDET
LIHSDAESESLLLPVKIGTQFQSSPTRGSERSPQTVLAAHLKVPLVKVVVEERGIGSKPE
QSPVHSPDQHTAGPSAPQQNTTRTPPSPSPDQSKRHNATGSPLCSNLAISPPQPDTICVS
LISSSPSPVAPPFDPEPSFDSPSFWKSCNAAGCTQAIFTDFINEMNDISSRIQSDQASQE
DYDLALKVMAASGKLAELVAKQQKELQQKQMELTKAAAAMKEVFSALRR
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccgtcctaaagtttgctgtgtactctgtcagcgctccgaggagacagagata
accggagcattgtcgacaaaagatgaagtcactgctcatcagaactgtttgttattttcc
tctggtatttattgccagaattcaccagagtttgatgacctgtttggtttctctgtggaa
gatgtgatgaaagaggtcaaacgaggaggcaaactgacttgtaacaaatgcaagagaaag
ggtgccactgctgggtgtgaagtcggacgctgcaagaaatcctaccactacccttgtgcc
attcaggagggcgctaaggctattgaagaaccaggcgaggggaaatatgagctgttgtgc
ttcaaacactatcaacaacaacaaccaagagacagtgattctgttaatgggctgaaagct
gaaacctccaaaaatcacaatggagctggttcatctaaggtatattgtcttgcctgtgag
aacacagagggaaaaatcagcttggaatatttgtctaatggagttattatgttgtattgt
gacaaacatactccctcgtcatataagaggaatgccagtggagattctacggtgtctgga
ctacctgtgtgcagcagtgactcaaactcatccagcagtacgacacgtctttccaagaga
cggctgaatttcagtgacatacaagaggagaccccgtctaaacggaaaaggagaataatt
gatgattcttcagattcagatgagaatgtacccaacatagagtgtgcccctttagagtca
gacttcgaggaaaatgcaaactctgttccagagcaccaatttagcagaaaaggaagtggg
agacccacagcgtctacctcagatgaaagcagaggtagcaataaagatgaagatgaaaca
ttgattcattcagatgctgagtcagagagtctgctgcttcctgtgaagatcggcacacag
tttcagtcctctccaacaagaggttcggaacgttcacctcagacagtattagccgcacat
ctcaaagtgcctttggttaaggtggtggtggaggaaaggggaatagggtccaaacctgag
caaagtcctgtccacagtcctgatcaacacaccgctggaccctccgccccacagcaaaac
accaccaggacccctccctctccatcacctgaccagtccaagcgccacaatgctactggc
tcacctctgtgctccaacttggccatttccccgccccaacctgataccatctgtgtatcc
ctcatctcctcctcaccctctcccgtggcccctccctttgacccagagcccagcttcgac
tcccctagcttctggaaaagctgcaacgcggcaggatgtacacaggccatctttactgat
ttcattaatgagatgaatgatatctctagcagaattcagtctgaccaggccagccaggag
gattatgatcttgcactaaaagtgatggcggcttctgggaagctagcagagctggtggcc
aagcagcagaaagagttacaacagaaacaaatggagctgacaaaggcagcagcagctatg
aaggaggttttctcagcactgaggagatga

DBGET integrated database retrieval system