KEGG   Lates calcarifer (barramundi perch): 108901685Help
Entry
108901685         CDS       T04895                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial-like
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00071  Fatty acid degradation
lcf01212  Fatty acid metabolism
lcf03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108901685
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    108901685
Enzymes [BR:lcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     108901685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 108901685
NCBI-ProteinID: XP_018558765
Position
Unknown
AA seq 667 aa AA seqDB search
MASLLSVQCISSLRKSGSVINLRTVALGVNKRNYSSKKASSTEYLHESVVPSMHYQKSLP
RLPIPKLEDTIRRYLAAQRPLLDDDQFRATEKLAQDFQSSVGKQLHEELIAQDKNNKHTS
YISGPWFDMYLSARDSVVLNFNPFMSFNPDPQTQYNDQLVRATNMVCSAVRFMKTLRAGL
LEPEVFHLNPAKSDTDGFKKLIRWVPSSLSWYGAYMVNAYPLDMSQYFRLFNSTRIPKRG
RDELFTDEKGRHLLVMRKGNIYAFDIVDRDGNLVKPAEIQSHLKYILSDPTPAPAFPVGV
LTSENRDVWAGLRDKLSAAGNAENLQLVDSALFCLCLDDESMRDHIHISHNMLHGDGCNR
WYDKSFSIILTKDGQAAINFEHSWGDGVAVLRFQNEIFKDTTEQPLVHPGSAAAAVDSAS
AVHRLQFKLDSELEAGIKKAKENFDSAVSKLTIDAMEFKRGGKEQLKKSKLSPDAISQLA
FQMGFLRQYGETVATYESCSTAAFKHGRTETIRPATIHTKQCSHAFVCQPGQHSVEQLRG
MLNECSKYHGQLTKEAAMGQGFDRHLFALRYLANSKGQALHSLYTDPAYAAINHNILSTS
TLTSPAVSLGGFAPVVPDGFGVGYGVHDDWIGCNVSSYPARNVHEFLQCVHKSLEDIFTV
LEGKPLS
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggccagtctgctttcagtgcaatgcatttcttctctaagaaaatctggaagtgtaatt
aatttgaggactgttgcacttggcgtcaataagcgaaactacagcagcaaaaaagcgtct
tcaaccgaatatttgcatgaaagtgtggttccatcgatgcattaccagaagagtttacct
aggcttcccataccaaaattggaggatactatcaggaggtatttagctgcccagaggcct
ctgttggatgatgaccagttcagagccacagagaaacttgcacaggatttccaaagcagt
gtggggaaacagttgcatgaggaactgatagcccaggataaaaacaataagcacacaagc
tacatttcagggccatggtttgatatgtacctgtctgcacgtgactcagtggtgctgaac
ttcaaccccttcatgtccttcaatcctgaccctcagactcagtacaatgaccagcttgta
cgggcaactaatatggtgtgctcagcggtgcgcttcatgaaaacgctgcgagctggatta
ctggagccggaggttttccatttaaacccggcaaagagcgacacagatggcttcaaaaag
ttaatccgctgggtcccatcctctctgtcatggtatggagcctacatggtgaacgcttac
cccctggacatgtctcagtactttcgtctcttcaactcaactcgcattcccaagcgtggg
cgagatgagctcttcactgatgagaaagggcgacatcttctggttatgagaaaaggcaat
atctatgcatttgacatcgtggacagggatgggaatttagtgaagcccgcagagatccag
tcccacttgaaatacattttgtctgacccgacaccagcacctgcctttcctgttggtgtg
ctgaccagtgagaacagggatgtgtgggctgggctgagggacaagctgtcagctgctggg
aacgcagagaatttacagcttgtcgacagcgctcttttctgtctctgcctggatgatgaa
agcatgcgagatcacattcacatctcccacaacatgctgcacggcgacggctgtaaccgc
tggtacgacaagtccttcagcatcattctcaccaaagacggacaggcggccattaatttt
gagcactcctggggcgatggtgtagctgtgctccgctttcagaatgagatcttcaaagac
acaacagagcagcctttggtacatccaggctctgctgctgctgctgtggattcagcctcc
gctgtgcacagactgcagttcaaactggacagcgagctggaggctggtatcaaaaaagcc
aaggagaactttgattcagccgtgtcaaaactcaccatcgacgccatggagttcaaaagg
ggtgggaaggaacagttaaagaagagcaagttgagtccagatgcgatatcccaactggcc
tttcagatgggcttcctgaggcagtacggagagacagtggccacatatgaatcatgtagc
actgcagcattcaagcatggtcgcacagagacaatccgaccagctaccatacacaccaaa
caatgttcacatgcctttgtttgccagccgggacagcacagtgtggagcagctacggggc
atgctcaatgaatgctcgaagtatcatgggcagctcaccaaggaagcagctatgggccaa
ggttttgaccgacatctctttgccctgcgatacttggccaactcaaagggccaagctctg
cacagcctgtacactgaccccgcttacgcggctatcaaccacaacatcctctccaccagc
accctcaccagcccagccgtgagcctcggtggctttgcccccgtggtgcctgacgggttt
ggcgtcggctatggtgtccatgatgactggatcggctgtaacgtgtccagctacccagct
cgcaatgtccatgaattcctgcagtgtgtccacaagtctttagaggatattttcacagtc
ctggagggaaagccactcagttaa

DBGET integrated database retrieval system