KEGG   Lates calcarifer (barramundi perch): 108902106
Entry
108902106         CDS       T04895                                 

Definition
(RefSeq) 11-cis retinol dehydrogenase-like
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    108902106
Enzymes [BR:lcf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     108902106
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 108902106
NCBI-ProteinID: XP_018559352
UniProt: A0A4W6E1D3
Position
Unknown
AA seq 332 aa
MDTQFVYDLLGENAWLYISATFVVLWIIMWLYRDSLEIENITDKYVFVTGCDSGFGNLLC
KKLDRKGFRVLAGCLTEKGADDLKRVTGPYLRTVLLDVTSQDSIEKAMEFTKKEVGDKGL
WGIVNNAGRSLPMGPTEWMKVEDFHSTLKVNMNGVIGMTMTFLPLIKKARGRIVNVASVL
GRVAANGGGYCISKFAVESFSDCLRRDINYFGVNVCIIEPGFFKTAVTSLDPLERELHRL
WNQLSPEVQASYGDKYLDKYIKVQRVIMNAVCDSDLTKVTSCMEHALTAAYPRTRYSAGW
DAKLIWIPLSYMPSCVVDIGLKLVLPRPSKSV
NT seq 999 nt   +upstreamnt  +downstreamnt
atggatacacagtttgtctacgaccttttaggagaaaacgcctggttgtacatcagtgct
acatttgtggtgctgtggattattatgtggctgtacagagacagcctggagattgagaac
atcactgacaaatacgtctttgtgactggctgcgactcgggctttggaaacttgctgtgt
aaaaagctcgacagaaaaggtttccgagtgctggctggctgtctcacagagaagggagct
gatgatctgaagagggtgacgggcccttatctgaggactgtcctgctggatgtgaccagt
caggacagcatcgaaaaggccatggagtttaccaagaaggaggttggcgacaagggtctt
tggggtattgtgaacaatgctgggcgttcattacccatgggtcctacagagtggatgaaa
gtggaggatttccacagcacactgaaagtcaacatgaatggagtgattggcatgacgatg
actttcctgcctctcatcaaaaaggctcgtggtcgtattgtaaacgtagcatcagtgctc
ggtagagtggcggcaaacggtggtgggtactgcatctctaagtttgcagtggagtctttc
tctgactgtctcaggagagatataaactactttggagtgaacgtgtgcatcattgagccg
gggttttttaagactgcagtgacgagcctcgatcctctggagagagagctgcatcgtctg
tggaaccagctcagtcctgaagttcaggccagctatggagacaagtacctggataaatac
atcaaggtgcagcgtgtgatcatgaacgctgtctgcgactctgacctcaccaaggtgacc
agctgcatggagcacgctctgacagctgcctacccacgcaccagatacagtgccggctgg
gatgccaagcttatctggatccccctctcttacatgccttcctgtgtggtagatattggg
ctgaagctggtgctgcctcgtccttcaaagagcgtgtaa

DBGET integrated database retrieval system