KEGG   Lates calcarifer (barramundi perch): 108902937Help
Entry
108902937         CDS       T04895                                 

Gene name
atg16l1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04136  Autophagy - other
lcf04140  Autophagy - animal
lcf04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108902937 (atg16l1)
   04136 Autophagy - other
    108902937 (atg16l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    108902937 (atg16l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcf04131]
    108902937 (atg16l1)
   03029 Mitochondrial biogenesis [BR:lcf03029]
    108902937 (atg16l1)
Membrane trafficking [BR:lcf04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    108902937 (atg16l1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    108902937 (atg16l1)
Mitochondrial biogenesis [BR:lcf03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108902937 (atg16l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 KASH_CCD ADIP
Motif
Other DBs
NCBI-GeneID: 108902937
NCBI-ProteinID: XP_018560484
Position
Unknown
AA seq 620 aa AA seqDB search
MAERRVECTWKRHISEQLKLRDRVQRQAFEEIIHQYNRLLEKSDLQAVLSERYQTDKYDV
QRGHETSSGSDSSRSDALQQEMAQMRIRHQEELTELHKKRGELAQSVIELNNQIQQKDKE
IQSNEAKMLEYQQQIASLEGDCRELRSYLQDLERANQTLKDEYDALQITFSALEEKLRKT
TEDNQELVSRWMAEKAQEANRLNAENEKDSRRRQAKLQKELADAAKEPLPIDPDDDIEVL
AEDGGKGGGETSPNRPLSRTPSKKISQPPPGGLLDSISNIFGVSECVQPGLLPPHSRRRT
ANSFSTSPENTEAPSGGCAEVRVPTTALHVFEAHDGEVNAVRFSPGSRLLATGGMDRRVK
LWEVIAGRCESKGALTGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGH
SGKVLSARFLLDNARIVSGSYDRTLKLWDLRSKVCMKTVFAGSSCNDIVCTEQCVMSGHF
DKKVRFWDIRAESIVRELELLGRVTSLDLNHDRTELLTCSRDDLIKIIDLRTNAVRQTFS
AQGFKCGADWTRVTFSPDGSYVAGGSADGALYVWNVLTGKVDRTLDRNHNSAINSVSWSP
SGAYVASVEKGSKAILWSDM
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcggcgggtggagtgtacttggaagagacacatctcagagcagctgaagctc
agagaccgggtccagaggcaggccttcgaggagatcatccaccaatataatcgtctgctg
gagaagtccgacctccaggctgttctgtctgagagataccagactgacaaatatgacgtc
cagagaggacacgagaccagttcgggctcagactcgagtcgcagtgatgctctgcagcag
gaaatggctcagatgaggatcagacaccaggaggagctgacggagcttcacaagaagaga
ggagagctggctcagagtgtgattgaactgaacaaccagatccaacagaaggacaaagag
atccagagcaacgaggccaagatgttggagtatcagcagcagattgccagcctagaggga
gactgtcgggagctgaggagctacctgcaggacctggagcgggcgaaccagaccttgaag
gacgagtacgacgccctgcagatcaccttctctgctctggaggagaagctgaggaaaacc
acggaggacaaccaggagctggtgtctcgctggatggccgagaaggctcaggaggccaac
aggctgaatgccgagaacgagaaggacagcagacgacgacaggccaaactgcagaaggag
cttgcggacgctgctaaagaacctctgcccatcgacccggacgacgacatcgaggtcctg
gccgaggacggagggaaggggggtggagagacctcacccaacagaccactcagtagaact
cccagtaagaaaatctctcagcctcctcctggtggactcctggactctatctccaacata
tttggcgtgtctgagtgtgttcagcctggactcctcccaccacactccaggcgtcgaact
gccaactctttcagtacctcacctgagaacacagaggctccgtcaggaggctgcgccgag
gtccgagtcccgaccacagctctgcacgtgtttgaggcccatgatggtgaggtaaacgct
gtccggttcagcccaggctctcgtctcctggcgacgggagggatggatcgcagggtgaag
ctgtgggaggtcatcgcaggtcgctgtgagtctaaaggagcgctgactggcagtaatgca
ggaatcaccagcatcgagttcgacagtgctggttcgtacctgcttgcggcctctaatgac
ttcgccagtcgtatctggaccgtggacgactacagactgaggcacactctgacaggtcac
agtgggaaggtgttgtcagctcgtttcctattggacaacgctcggatcgtctccgggagc
tacgaccggacgctcaaactgtgggacctccgcagcaaagtctgtatgaagacggtgttt
gcgggctccagctgtaacgacatcgtctgcacagagcagtgcgtcatgagcggacacttc
gataagaaggttcggttctgggacatcagagcggagagtatcgtgcgggagctggagctg
ctgggcagagtgacgtctctggacctgaaccacgaccggactgagctgctcacctgctcc
agagatgacctgatcaagatcatcgacctgcgcaccaacgccgtcagacagaccttcagt
gctcagggctttaagtgtggagctgactggaccagagtcaccttcagtcctgacggcagc
tacgtggccggaggatcagctgatggagctctgtacgtctggaacgtcctgacggggaaa
gtggaccgaacgctggaccggaaccacaactctgccattaactcggtgtcctggtcgccg
tcaggagcgtacgtggcgagcgtggagaaaggcagtaaggccatcctgtggtctgacatg
tga

DBGET integrated database retrieval system