KEGG   Lates calcarifer (barramundi perch): 108902958Help
Entry
108902958         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcf04131]
    108902958
Membrane trafficking [BR:lcf04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    108902958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 108902958
NCBI-ProteinID: XP_018560514
Position
Unknown
AA seq 2118 aa AA seqDB search
MTSTASERRAFAHKINRTVAAEVRKQVSRDYGSPQLSKKRGGAHHPLPLTEVVDPVDFEE
YVSSHAPGVEPGPLRQLTEFPQDDLELLHLDKECTTLEPPLPEEDSLDPRVRDALAVYTD
DWLVIQRKYQRYSTMYTPHNSERQRERQKGLVKQTFELDEAAAAERQDDQDDAKRRSVSL
DETPRGSWASSIFDLKNSSPDALLPSVLERAAAEDMDRRNTEARLQGRHSDLLGLYPPPD
EDEAVERCSVPEVPKEHCGQRIMVKCLSLKFEIEIEPIFGTLALYDVKEKKKISENFYFD
LNSDQMKGLLKPHTPHIAISTLARSAIFSITYPSADIFLVIKLEKVLQQGDIGECCEPYM
VMKESDSTKHKEKLEKLRLQAEQSCSRLGRFRMPFAWTAIHLLNIVSSVGGLDRSDPDSD
SERKGHGTWNERKKKGFERMSVGDDMCNFATFRPATLTVTNFFKQEGDRLSDEDLYKYLA
DMRRPSSVLRRLRPVTAQLKIDISPAPDSPHYCLSPELLHVKPYPDLRVRPTKEVQEFPA
RYVYTPHTTYRNLLYVYPQSLNFTSRQGSVRNIAVKVQFMAGEDPSQALPVIFGKSSCAE
FIKEAYTPVIYHNKSPEFYEEMKMKIPANLTDNHHLLFTFYHISCQPKQNTPLETPVGYT
WIPLMQHGRLRTGSFSLPVSVEKPPPSYSVLTPDVQLPGMKWVDNHKGVFNVEVTAASSV
HTQDPHLDKFFTLVYVLEEYSFPFRLKDVIITEANMEGELKASMAALRGALLDTCVRFLH
QLLNKLIQLIVYPPVIAGQIVNLGRAAFEAMALLVNQMHKNLEGNQDQHGRNNLLASYIH
YCFRLPTAEPTIPPTAGTQSYEMPMQYATLSRATARPSSLLLSRSKSISNSNPDLASTPV
SPDEEVQRIIGSKGIDRSHSWVNSAYAPGGSRSVLRRNPNSSCELKQANDRSCNRMSAFL
DSVALFSVPTRQITKKLLHEELALQWVVSTSTVREAALQQSWFFFQLMTKSMAHHLFLTS
KLDVPRRQRFPDRFVDDIAALVCAISADIASRYHKDVELVERLNSSLAFFLNDLLSLMDR
GFVFNLIRSYYKQIANKLHTAQNPSSLNALRMDFTRIVCSHEHYVILNLPCSTLSPPASP
SPSTSSTTSQSSAFSSMVQDQGVATMFELSVPFRQQHFLSGLLLSELSLILDPDGEGVFF
LHKKAISAVHSLLCSHDADPRYSEPQVRAHVAQLYLPLIPIVMESLHQLHDFSDSSPVRV
RHASAHADDADPDSSNTISQSVAMAIAGSPLPHAKANAFALPTVAGRQSSSLSAECSRTL
LVCFLWVLKNADAALLERWVSDLSVLQINRLLDLLHLCVSCFEYKGKKALERINSLTFKK
SQDMKARLEEAILGTIGARQEMVRRCRERSPYGSQENVRWRKNVSHWRQNTDRVDKTKAE
VEQESVVDGNLATEASLIVLDTLEIIVMTVVASELKESVLGGVLRVLLHSMAGNQSALFL
QHCFTTQRALVFKFPEMLFEEDTELCADLCLRLLRHCSSSVGSVRSHASASLYLLMRQNF
EIGNNFARVKMQVTMSLSSLVGTSQNFNEEHLRRSLKTILTYAEEDLELRDTPFPEQVQD
LVFNLHMILTDTVKMKEHQQDPEMLIDLMYRIAKGYQNSPDLRLTWLQNMAGKHSERGNH
AEAAHCLVHSAALVAEYLNMLEDCRYLPIGCVTFQNISSNVLEESAVSDDVLSPEEEGIC
AGKYFSESGLVGLLEQAAASFNMAAMYEAINEVYKILLPIHEANRDFKKLATVHGKLQDA
FNKVYNQSSGWERMFGTYFRVGFYGCRFGDLDEQQFVYKEPSITKLAEISHRLEEFYSER
FGDEVVEIIKDSNPVYKNKLDPNKAYLQITYVEPYFDTYELKERITYFDKNYNLRTFMYC
TPFTLDGRAHGDLHEQYKRKTILTTSHAFPYIKTRINVIHKEEIILVPMEVAIEDMQKKT
QELAFATNQDPADSKMLQMVLQGCVGTTVNQGPLEVAQVFLSDIPNDPKLFRHHNKLRLC
FKDFTKRCEDALRKNKALIGPDQKEYHRELERNYNKLKEALGPLINRKIPQLYRTLPTQT
TQTQRNSYSRSSLRRVDC
NT seq 6357 nt NT seq  +upstreamnt  +downstreamnt
atgacatccacggccagcgaaaggagggcgtttgctcataaaatcaaccggacggttgct
gcagaggtcaggaaacaagtgtccagagattatggctctcctcaactgtccaagaaacga
ggcggcgcacaccaccctttgcccctgacagaggtggttgatcctgtcgatttcgaggag
tatgtgagcagtcacgctcccggggttgagcctggccccctcagacagctaacagagttc
ccccaggacgacctggagctcctccacctggacaaagagtgcactacactggagcccccg
ctgcccgaggaggactcactggatcccagagtgagagatgccttagcagtctacacagat
gactggcttgtcattcagagaaagtatcagcgctacagcaccatgtacacccctcacaac
tctgagcgacagagggagaggcagaaagggctggtcaaacagacctttgaactggatgag
gctgccgccgctgagcgccaggatgaccaggatgatgcaaagcggcggtcggttagcctc
gatgaaacccccagaggcagctgggcctccagcatctttgacctgaagaactcttcccca
gatgccctcctgccgtctgtgctggagcgtgcagctgcggaggacatggaccgccgcaac
acagaggcacgactgcaggggcgccacagtgacctgctgggcctgtatcctccccctgat
gaggatgaagcagtagagagatgctctgttcctgaagtacccaaggaacattgtggccag
aggatcatggtcaagtgtctgtctctgaagtttgaaatagaaattgagccaatatttgga
acactcgccctctatgatgtcaaggaaaagaaaaagatctctgagaatttctactttgac
ctgaactcggatcaaatgaaagggctgcttaaaccccacacgcctcacatagccatatcc
acactggcccgttctgccattttctccatcacatacccatctgccgatatcttcttggtc
attaagcttgagaaagtccttcaacaaggggacattggagaatgctgtgaaccctacatg
gtcatgaaagaatcagattccaccaagcacaaggagaagctggagaagctgcgtctgcag
gcggaacagtcgtgcagtcgtctcggtcgtttccgcatgccttttgcctggacagccatt
caccttctcaacattgtcagcagtgtgggaggtctggatcggtcagacccggactctgac
tctgagagaaaaggtcatggaacatggaatgagaggaagaagaagggctttgagcgaatg
agtgtcggggacgacatgtgtaactttgccactttccgaccagcaactctcactgtcacc
aacttcttcaaacaggagggggacagactaagtgatgaagacctctacaagtatctggca
gatatgcgcaggccatcatctgttctgcggagattgagacccgtcacagcccagttgaag
atcgacatctctccagctccggactcgcctcattactgtctgtcaccggagctgcttcat
gtaaagccctaccctgacctgcgtgttcgtccaaccaaagaggtgcaggagttccctgct
cgttatgtatacactccgcacaccacctacaggaatctgctgtatgtttacccacaaagt
ttgaacttcaccagtcggcagggctcagtgaggaacatcgctgtgaaggttcagttcatg
gcaggagaggaccccagtcaagctttgccggtcatctttggaaagtcaagttgtgccgag
ttcatcaaagaggcgtacacccccgtcatctaccacaacaagtctcctgagttctatgag
gagatgaagatgaagattcctgccaatctgacagacaaccaccatcttctgttcaccttc
taccacatcagctgccagcccaaacagaacactcctctggagacccctgtgggctacact
tggatccctctgatgcagcatggccgactacgcaccggctccttcagtctgcccgtctcg
gtggaaaagcctccacctagctactctgtgctcacccctgacgttcagctcccaggcatg
aagtgggtggataatcacaaaggagtgttcaatgtcgaggtgacagcggcctcctcggtt
cacactcaggacccccacttggataagttcttcaccctggtgtatgttctggaggagtac
tccttccccttccgcctaaaagacgtcatcatcacagaggcaaacatggagggggagctg
aaggccagcatggcagcgctgagaggggcactgctggacacctgcgtcaggtttttgcac
cagctgctcaacaagctcattcagctcattgtctacccaccggtcattgcaggccaaatt
gtaaatctgggccgtgctgcctttgaagctatggctttgttggtcaaccagatgcacaag
aacctggaggggaaccaggatcagcatggccgcaacaacctgctggcatcctacatccac
tactgcttccgcctgcccaccgccgaacctacaattcccccgacagcaggcacccagtcc
tatgagatgcccatgcagtacgccaccttgtcaagagcaacagcccgcccaagcagcctg
ctcctgtcccgctccaagagtatcagcaactccaaccctgacctggccagcacaccagtt
tctcctgatgaggaagtgcaaaggatcatagggagcaagggcattgaccgctcccactcc
tgggtaaactctgcttatgcccctgggggctccagatctgtgctacgccggaacccaaac
tccagctgtgagctcaagcaggcaaacgaccgcagctgcaatcgcatgtctgcctttctg
gacagcgtggccttgttttcagttcccacaaggcagattaccaagaagctactccatgag
gagctggcattacagtgggtggtgagcaccagcacagtgagggaagcagcgctgcagcag
tcttggtttttcttccagcttatgacaaagagcatggcccatcatttattccttacctcg
aaattggacgttcccaggcgtcagcgtttcccagaccgctttgtggacgacatcgctgcg
cttgtgtgtgccatcagtgcagacattgccagccgctaccacaaggatgtggagcttgtg
gagaggttaaacagcagtctggccttcttcctgaatgacctgctgtctctcatggaccgg
ggctttgttttcaatctcatccgttcctactacaaacagatcgccaacaagctccacaca
gcgcagaatcccagctctctgaatgcactgaggatggacttcacccgtattgtctgcagc
cacgagcactatgtcatcctcaacctgccgtgctcaactctcagccccccagcctccccc
tccccctcaacctcctccaccacctcacagagttcagctttttccagtatggtgcaagac
caaggtgtggccaccatgtttgagctctccgtcccttttcgccagcagcacttcctgtct
ggcctgctgctttctgagctctctctcattcttgatcctgatggagaaggggttttcttc
cttcataaaaaggccattagtgctgttcactccctgctctgcagccatgatgcagaccct
cgctacagtgagcctcaggtcagagcccacgttgctcagctctacctgcccctcatcccc
atcgtcatggagtcgttgcatcagctccacgacttctccgactcctcgcctgttcgggtc
cgccatgcctcagcccacgccgacgatgctgacccagacagtagcaacactatcagtcag
tctgttgccatggcgattgccggctcccctttgccgcatgccaaagccaacgcatttgcg
ctgcctacagtggccgggcgccagtccagctctctgtccgccgagtgcagcaggactctg
ctggtgtgtttcctgtgggttctgaagaatgcagatgcagctctcctggagcgctgggtg
tctgatttgtctgtgttgcaaatcaaccgcctgctggatctgctgcatctctgtgtctcc
tgctttgaatacaaggggaagaaagctctggagaggatcaacagcctaacatttaaaaag
tctcaggacatgaaggcccgactagaggaggccatactgggcaccatcggagctcgtcag
gagatggtccgccgctgcagagagaggagtccctatggcagccaagagaacgttaggtgg
agaaagaacgtctctcactggagacaaaacacagacagagttgataagactaaagctgag
gtggagcaggagtctgtggtggatggaaacctagctaccgaggcctctctaatagtacta
gacacactggagattatagtcatgacggtggtggcgtcagagctgaaggaaagtgtttta
ggcggggtgctgcgagtgcttctccacagtatggcaggcaaccagagcgccctctttctg
cagcactgcttcactacacagagggctctggtttttaagttcccagagatgctgtttgaa
gaggacactgagctttgtgcggacttgtgccttcgtctccttcgccactgcagcagcagt
gttggctctgtcagaagtcacgcctctgcctctctttacctgctcatgaggcagaacttt
gagataggaaataactttgcacgagtaaagatgcaggttactatgtctctgtcttcgctg
gtgggaacgtcgcagaacttcaacgaggagcatcttcgccggtcactcaagacgatccta
acatatgctgaagaggacttggagctgcgtgacactcccttcccagagcaggtccaggat
ctggtgttcaacctgcacatgattcttactgacactgtgaagatgaaagagcatcagcag
gatccagagatgctcattgacttaatgtacaggattgctaagggctaccagaactcacca
gatctgcgtcttacgtggctccagaacatggcaggaaaacactctgagagagggaaccat
gccgaggctgcccactgtctggtccacagcgccgcactggtggcagaatacctcaacatg
ctggaggactgtcgctacctgccaattggttgtgtcacatttcagaatatttcttccaat
gtcctggaggagtccgcagtgtccgatgatgtcctgtctccagaggaggaggggatttgt
gctgggaagtacttcagcgagtctggcctggtgggcctcctggagcaagcagctgcctct
tttaacatggcagccatgtacgaggccataaatgaagtctacaagattctgctgcccatc
catgaagccaacagagacttcaaaaagctggcgactgtccatggaaaactgcaggatgcc
ttcaacaaagtctacaaccaaagttcaggatgggagagaatgtttgggacctactttcgg
gttggtttctatggctgtcggtttggagacctggatgaacaacagttcgtctacaaggag
ccatcgatcaccaaattagcagagatctcccacagacttgaggagttctactcagagagg
tttggggatgaggttgtcgaaattatcaaggactccaacccagtgtacaaaaacaaactg
gatcccaacaaggcctacctccagatcacctacgtcgagccgtactttgacacatacgag
ctaaaggaaagaatcacctacttcgacaagaactacaatctgcgcaccttcatgtactgc
acccccttcactctggatggccgagcccacggggacctgcatgagcagtacaaacgcaaa
accattctgacaacatctcacgccttcccttacatcaagacacgcatcaacgtcatccac
aaggaggagattattctagtccccatggaggtggccattgaggacatgcagaaaaaaact
caggagctcgccttcgccacaaaccaagaccctgcagactccaagatgctgcagatggtg
ctgcagggctgtgtgggcaccactgtcaaccagggccccctcgaggtggcgcaggtcttt
ctttccgacattcctaatgacccaaaactgttccgccatcacaacaaactgcgcctctgc
tttaaagacttcactaagaggtgtgaggatgccctgaggaagaataaagcactgattgga
ccagatcagaaggagtaccacagagagctggagaggaactacaataaactgaaagaagct
ctgggacctctcatcaaccgcaagatcccccagctatacagaaccctgccaactcagact
acgcaaacacaacggaattcctacagtaggtccagtctccgccgagtcgactgttga

DBGET integrated database retrieval system