KEGG   Leptothrix cholodnii: Lcho_0040Help
Entry
Lcho_0040         CDS       T00681                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lch  Leptothrix cholodnii
Pathway
lch00071  Fatty acid degradation
lch00072  Synthesis and degradation of ketone bodies
lch00280  Valine, leucine and isoleucine degradation
lch00310  Lysine degradation
lch00362  Benzoate degradation
lch00380  Tryptophan metabolism
lch00620  Pyruvate metabolism
lch00630  Glyoxylate and dicarboxylate metabolism
lch00640  Propanoate metabolism
lch00650  Butanoate metabolism
lch00900  Terpenoid backbone biosynthesis
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01130  Biosynthesis of antibiotics
lch01200  Carbon metabolism
lch01212  Fatty acid metabolism
lch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lcho_0040
   00630 Glyoxylate and dicarboxylate metabolism
    Lcho_0040
   00640 Propanoate metabolism
    Lcho_0040
   00650 Butanoate metabolism
    Lcho_0040
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Lcho_0040
   00072 Synthesis and degradation of ketone bodies
    Lcho_0040
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Lcho_0040
   00310 Lysine degradation
    Lcho_0040
   00380 Tryptophan metabolism
    Lcho_0040
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Lcho_0040
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Lcho_0040
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Lcho_0040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lch04147]
    Lcho_0040
Enzymes [BR:lch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Lcho_0040
Exosome [BR:lch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lcho_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ACB32315
UniProt: B1Y585
Position
complement(44116..45387)
Genome map
AA seq 423 aa AA seqDB search
MSHPKQPGLYQAFDDVHLIDGLRTPQVDHLGAFADANPIDLGIHAARAVIERSGVDATAI
DSVLGGNMAPGGFDQFYLPRHIGLYAGVPVEVPALMAQRICGTGFELFRQAGEQIDAGIA
SLALVVGTESMTRHPIAMFDHRGGFKLGQTPALKDYLWESLTDPVAAVSMIQTAENLAQK
YGITRAEVDAFAARSFARAVAAQEAGWFDGEIAPVESSVFELPGYQPRALRLSGKNKRAD
RDTHPRPTPADVLALLRPVFKDGVQTAGNCSALTDAAAAALVASGVVVRDWQARTGRAPL
ARIAATAVVGVPPEIMGIGPAPAIRRLLDGAGLTLDDIARFEVNEAQGAQTLAVARELGL
AEDRLNVHGGAIALGHPLAATGVRLTITVARQLQAIGARWGVASACIGGGQGIALLVENT
AVG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagccatcccaagcagccgggcctgtatcaggccttcgacgacgtccacctgatcgac
ggcctgcgcacgccgcaggtcgaccacctgggggcctttgccgatgccaaccccatcgac
ctgggcatccatgctgcacgtgcggtgatcgagcgcagcggcgtcgacgccaccgccatc
gactcggtgctgggcggcaacatggcgccgggcggcttcgaccagttctacctgccgcgc
cacatcggtctgtacgccggcgtgccggtggaggtgccggcgctgatggcgcagcgcatc
tgcggcaccggcttcgagctcttccgccaggccggcgagcagatcgacgccggcatcgcc
agcctggcgctggtggtgggcaccgaatcgatgacgcgccacccgatcgcgatgttcgac
caccgcggcggcttcaagctcggccagacgccggcgctgaaggactacctctgggagtcg
ctcaccgacccggtcgcggcggtctcgatgatccagaccgccgagaacctggcgcagaag
tacggcatcacccgcgccgaggtcgatgcgtttgccgcacgttccttcgcgcgcgccgtc
gcggcacaggaggccggctggttcgatggcgagatcgcgccggtcgaaagcagcgtgttc
gagctgcccggctaccagccgcgcgcgctgcgcctgtcgggcaagaacaagcgcgccgac
cgcgacacccacccgcgccccacgccggccgatgtgctggctttgctgcgcccggtgttc
aaggatggcgtgcagaccgccggcaactgctcggccctgaccgacgccgccgccgccgcg
ctggtcgccagcggcgtggtggtgcgcgactggcaggcccgcacgggccgcgccccgctc
gcacgcatcgccgccaccgcggtggtgggcgtgccaccggagatcatgggcatcggcccc
gcaccggccatccgccgcctgcttgacggcgcgggcttgacgctcgatgacatcgcccgc
ttcgaggtcaacgaggcccagggcgcgcagaccctggccgtggcccgcgaactcggtctg
gccgaggacaggctcaacgtgcacggcggcgccatcgcgctgggccacccgctggcggcc
accggcgtgcgactgacgatcaccgtggcccgccagctgcaggccatcggggcacgctgg
ggcgtggccagcgcgtgcatcggcgggggccaggggatcgcattgctggtggaaaacacg
gccgtcggctga

DBGET integrated database retrieval system