KEGG   Leptothrix cholodnii: Lcho_0173Help
Entry
Lcho_0173         CDS       T00681                                 

Definition
(GenBank) glycine cleavage T protein (aminomethyl transferase)
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
lch  Leptothrix cholodnii
Pathway
lch00260  Glycine, serine and threonine metabolism
lch00630  Glyoxylate and dicarboxylate metabolism
lch00670  One carbon pool by folate
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01130  Biosynthesis of antibiotics
lch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Lcho_0173
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lcho_0173
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Lcho_0173
Enzymes [BR:lch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Lcho_0173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: ACB32448
UniProt: B1Y6X0
Position
179958..181088
Genome map
AA seq 376 aa AA seqDB search
MTSWRISALADRHRALGSTLADWNGMGTAWTYSSDLADEHEAIRTHAGLMDVSGLKKVHV
IGPHAEALINQAVTRNVSKLYPGKSVYACMLNEAGKFIDDCVIYRNGPNAFMVVHGAGQG
HEILTRGAVGRNVAVLFDDDLHDLSLQGPLAVEYLSRHVPGIRQLPYFHHLQTTLFGRPV
MISRTGYTGERGYELFCKAADAPTIWDTIVAEGKAMGIVPCAFTALDWLRVESCLLFYPY
DNSDMYPMDGEPIGDTLWELGLDFTVSPGKTEFRGAAEHFRLQGRERFKIFGIELDSTEA
AQAGDALYDGDTKVGFVTCGMYSRLSGRSMAIARMDTAYAVPGRKLALRGAALNCAASTH
SLPFDDPQKTKRMAKD
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttggcgcatctcggccctggccgatcgacaccgcgcgctgggctcgaccctg
gccgactggaacggcatgggcacggcctggacctacagctccgacctggccgacgagcac
gaagccatccgcacccatgccggcctgatggacgtgtcgggcctgaagaaggtgcacgtg
atcggcccgcacgccgaggccctgatcaaccaggcggtgacccgcaacgtcagcaagctc
tacccgggcaagtcggtctacgcctgcatgctcaacgaggccggcaagttcatcgacgac
tgcgtcatctaccgcaacggtcccaacgccttcatggtggtgcacggcgccggccagggc
cacgagatcctgacgcgcggcgcggtcggccgcaacgttgcggtgctgttcgacgacgac
ctgcatgacctgtcgctgcaggggccgctcgcggtcgagtacctgagccggcatgtgccg
ggcatccgccagctgccgtatttccatcacctgcagacgacgctgttcggccgcccggtg
atgatctcgcgcaccggctacaccggcgaacgcggctacgagctgttctgcaaggcggcc
gacgcgccgacgatctgggacaccatcgtcgccgaaggcaaggcgatgggcatcgtgccc
tgcgcgttcaccgcgctcgactggctgcgggtcgagagctgcctgctgttctacccctac
gacaactccgacatgtacccgatggacggcgagcccatcggcgacacgctgtgggagctg
gggctggacttcacggtgtcaccgggcaagaccgagttccgcggcgcggccgagcacttc
cgcctgcaggggcgtgagcgcttcaagatcttcggcatcgaactcgacagcaccgaggcg
gcgcaggccggcgatgccctctacgacggcgacacgaaggtcggcttcgtcacctgcggc
atgtattcgcgcctgagcgggcgctcgatggcgatcgcgcgcatggacacggcctacgcc
gtaccgggccgcaagctggccttgcgtggcgccgcgctgaactgcgccgccagcacccac
agcctgccgttcgacgacccgcagaagaccaaacgcatggccaaggattga

DBGET integrated database retrieval system