KEGG   Leptothrix cholodnii: Lcho_0495Help
Entry
Lcho_0495         CDS       T00681                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lch  Leptothrix cholodnii
Pathway
lch00020  Citrate cycle (TCA cycle)
lch00640  Propanoate metabolism
lch00660  C5-Branched dibasic acid metabolism
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01130  Biosynthesis of antibiotics
lch01200  Carbon metabolism
Module
lch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lcho_0495
   00640 Propanoate metabolism
    Lcho_0495
   00660 C5-Branched dibasic acid metabolism
    Lcho_0495
Enzymes [BR:lch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Lcho_0495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACB32770
UniProt: B1XY01
Position
complement(536311..537471)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKAILRQFDIPVPRGHAAFTVQEAVEAAQKLGGPVWVVKAQIHAGGRGKGGGV
KVAKSLDDVKKLAEQILGMQLVTHQTGPEGQKVRRLYIEDGADIQKEYYVSLVTDRQSQK
VAFIASSEGGMDIEEVAHSTPEKIITEVIDPLTGLGAEQAEKIARAIGLPAESIAQAVTL
FQNLYRCYMETDASLVEINPLNRDSKGGLIALDAKFNFDANALFRHPEIVACRDLDEEDP
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATAEKVTE
AFKIMLKNPEVKGILVNIFGGIMKCDTIAEGVITACKAVNLSVPLVVRMKGTNEDLGKKM
LAESGLPIIAADTMAEAATAIVNAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccacgagtaccaaggcaaggcgatcctgcgccagttcgacattccggtgccg
cgcggccatgctgcgttcacggtgcaagaggcggtggaagccgcgcagaagctcggcggc
ccggtgtgggtcgtgaaggcgcagatccacgccggtggccgtggcaagggcgggggcgtc
aaggtcgccaagagcctcgatgacgtcaagaagctcgccgagcagatcctgggcatgcag
ctggtcacgcaccagaccggccccgaaggccagaaggtgcgccgcctctacatcgaagac
ggcgccgacatccagaaggagtactacgtctccctggtcaccgaccgccagtcgcagaag
gtcgccttcatcgcatcgagcgaaggcggcatggacatcgaggaagtcgcccactcgacg
cccgagaagatcatcaccgaagtgatcgacccgctgaccggcctgggcgccgagcaggcc
gagaagatcgcccgcgccatcggcctgccggccgagtcgatcgcgcaggccgtcaccctg
ttccagaacctctaccgctgctacatggagacggacgcctcgctggtcgagatcaacccg
ctcaaccgtgacagcaagggcggcctgatcgcgctggacgccaagttcaacttcgacgcc
aacgcgctgttccgccaccccgagatcgtcgcctgccgcgacctcgacgaagaagatccg
gccgaagtcgaagccagcaagttcgatctggcctacatcagcctggacggcaacatcggc
tgcctggtcaacggcgcgggcctggcgatggcgacgatggacaccatcaagctgttcggc
ggcgagccggccaacttcctcgacgtcggcggtggcgccaccgccgagaaggtgaccgaa
gccttcaagatcatgctcaagaaccccgaggtcaagggcatcctggtcaacatcttcggc
ggcatcatgaagtgcgacaccatcgccgaaggcgtgatcacggcctgcaaggcggtcaac
ctgtcggtgccgctggtggtgcgcatgaagggcaccaacgaggacctgggcaagaagatg
ctggccgaatcgggcctgccgatcatcgctgcggacacgatggccgaagccgcgaccgcg
atcgtcaacgccgtcaagtaa

DBGET integrated database retrieval system