KEGG   Leptothrix cholodnii: Lcho_0704Help
Entry
Lcho_0704         CDS       T00681                                 

Definition
(GenBank) non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
lch  Leptothrix cholodnii
Pathway
lch00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:lch00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Lcho_0704
Enzymes [BR:lch01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Lcho_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ACB32979
UniProt: B1Y0J8
Position
complement(753389..754027)
Genome map
AA seq 212 aa AA seqDB search
MRLVLASNNAKKLKELGTLLAPAGVELVTQGSLGIAEAEEPHHTFIENALAKARHAAAAS
GLPAIADDSGLCVDALGGQPGVQSAHYATLDPADIDGLAREALRERQDAANNRRLLSALD
GQANRRARFVCTLVAIRSADDPEPLVALGRWEGELLTGLRGSGGFGYDPLLSIPALDATV
AQLDAETKNRHSHRALAAEQMVALMRSAWHLA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcgtgctcgcctccaacaacgccaagaagctcaaggagctgggcacgctgctg
gcgccggccggtgtcgaactggtcacgcaaggcagcctgggcatcgccgaggccgaggag
ccgcaccacaccttcatcgagaacgcgctcgcgaaagcccgccacgccgcggcggcgagc
ggcctgccggcgatcgccgacgactcgggcctgtgtgtcgacgcgctcggcggccagccg
ggcgtgcagtcggcgcattacgccacgctcgatccggccgacatcgacggactggcgcgc
gaggcgctgcgcgaacggcaggacgccgccaacaaccggcgcctgctgagcgcgctggac
ggccaggccaaccggcgcgcccgcttcgtctgcacgctggtggcgatccgctcggccgac
gatcccgaaccgctggtcgcgctgggccgctgggaaggcgaactgctgaccggattgcgc
ggcagcggcggcttcggctacgacccgctgctgtcgatcccggcgctggacgcgaccgtc
gcgcaactcgacgccgagaccaagaaccgccacagccatcgcgcgctggccgccgagcag
atggtcgcgctgatgcgcagcgcctggcacctcgcctga

DBGET integrated database retrieval system