KEGG   Leptothrix cholodnii: Lcho_0729Help
Entry
Lcho_0729         CDS       T00681                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lch  Leptothrix cholodnii
Pathway
lch00230  Purine metabolism
lch01100  Metabolic pathways
Module
lch_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Lcho_0729
Enzymes [BR:lch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Lcho_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase AAA_16 MMR_HSR1 ABC_tran AAA_18 AAA_22
Motif
Other DBs
NCBI-ProteinID: ACB33002
UniProt: B1Y0M1
Position
777448..778077
Genome map
AA seq 209 aa AA seqDB search
MKIMEFPGNLYVVAAPSGAGKSSLVKALLELDARLMVSVSHTTRKPRGQEQDGREYWFIP
EPAFRAMIAHGDFFEWAEVHGNLYGTSRAAIEARLKAGEDVVLEIDFQGALQIKQLFPMA
VLIFILPPSWSELRQRLLRRGEDAGEVIEQRMVNARHEVAQARHFDYIVVNALFETALFD
LKTIVHAQRLKYAAQRRSRPAVFDALQLS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcatggaatttcccggcaatctctatgtcgtcgcagcgccttccggggcgggc
aaatcgagcctggtcaaggccctgctggaactggatgcgcgcctgatggtgtcggtctcg
cacaccacgcgcaagccgcgtggccaggagcaggacggccgcgaatactggttcatcccg
gagccggcgttccgcgccatgatcgcgcacggcgactttttcgagtgggccgaggtgcac
ggcaacctgtacggcacctcccgcgcagcgatcgaggcccgcctgaaggcgggcgaggat
gtggtgctggagatcgacttccagggcgctctgcagatcaagcagctgttcccgatggcg
gtgctgatcttcatcctgccgccgtcgtggagcgagcttcgtcagcgtctgctgcggcgc
ggcgaggatgccggcgaggtgatcgagcagcgcatggtcaacgcccgtcacgaggtggcg
caggcgcggcatttcgactacatcgtcgtcaacgcgctgttcgagacggcgttgttcgac
ctcaagaccatcgtgcacgcacaacggttaaaatacgcggctcagcgccgcagccgcccg
gctgtgttcgacgcgctgcaactgtcctga

DBGET integrated database retrieval system