KEGG   Leptothrix cholodnii: Lcho_2851Help
Entry
Lcho_2851         CDS       T00681                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lch  Leptothrix cholodnii
Pathway
lch00970  Aminoacyl-tRNA biosynthesis
lch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lch00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Lcho_2851
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lch03029]
    Lcho_2851
Enzymes [BR:lch01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Lcho_2851
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Lcho_2851
Mitochondrial biogenesis [BR:lch03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Lcho_2851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACB35116
UniProt: B1XXJ6
Position
3137914..3139155
Genome map
AA seq 413 aa AA seqDB search
MAVDAEGSRQAAAAADRALLEGRDAGVLCGLAVSIKDLFDVQGQPTRAGSTWLGADQPAR
ADAPAVARLRKAGAALVGRTQMTEFAFSGVGINPHSGTPANAAMAALGRPDCVPGGSTSG
GAVSVACGAAWAALGSDTGGSIRIPAALHGLVGYKNTQALTPLHGSVPLAPSMDTVCAVT
RSVRDAVLLHQVLAQRRVALAGRTLSNLRLGWIRNHFLDGLDAEVAQAFEASLGTLAAAG
VQLKELRVDALAELPALTEQGGITAAEAWAWHAPHLAAHGHEYDPRVLGRIRRGASISAE
QLAALHQRRRAWITRMEAALADVDLVLSPTVPLIAPAMAPLLASDDEFFRVNALLLRNPA
VVNLLDGCAITLPCHTQSQPPVGLMLWAPGGRDDLLLDAAGAVEAALQPQRGA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgacgcggaaggttcgcgccaggcggccgccgcggccgatcgagccctcctt
gaaggccgcgacgccggcgtgctgtgcggcctggcggtcagcatcaaggatctgttcgac
gtccagggccagcccacccgagccggctcgacctggctcggcgccgatcaaccggcccgg
gccgatgcccccgccgtggcgcgcctgcgcaaggccggcgcagcgctcgtcggacgcacg
cagatgaccgagttcgccttttcgggcgtgggcatcaacccgcacagcggcacgccggcc
aatgccgcgatggcagcgctcgggcggcccgattgtgtgcccggcggatcgacctccggc
ggcgccgtgtcggtcgcctgcggcgcggcctgggcggcactcggcagcgacaccggcggc
tcgatccgcattcccgcggcactgcacggcctggtcggctacaagaacacccaggccctg
acgccgctgcacggcagcgtgccgctggcgcccagcatggacaccgtctgcgccgtcacc
cgcagcgtgcgcgacgccgtgctgctgcaccaggtgctggcgcagcgtcgcgtcgccctg
gccgggcggacgttgtcgaacctgcggctgggctggatccgcaaccactttctggacggc
ctcgatgccgaggtcgcacaggccttcgaggccagcctcggcacgctcgccgcggctggc
gtgcagctgaaggaactccgcgtggacgccctcgccgagctgccggcgctgaccgaacag
ggcggcatcaccgcagccgaagcctgggcctggcacgcgccgcacctggcggcgcacggc
cacgaatatgacccgcgcgtgctcgggcgcatccgccggggtgcgtcgatctcggccgag
cagctcgctgcattgcatcaacgccgccgcgcctggatcacgcgcatggaagcggcgctg
gccgacgtcgacctcgtgctcagccccaccgtgccgctgatcgccccggcgatggcgccg
ctgctggccagcgacgacgaattcttccgcgtcaacgcgctgctgctgcgcaaccccgcc
gtcgtcaacctgctcgacggctgcgcgatcacgctgccttgccacacgcaaagccagccc
cccgtcgggctgatgctgtgggcgccaggcgggcgtgacgatctgctgctcgacgccgcc
ggcgcggtcgaagccgccttgcaaccgcagcggggcgcctga

DBGET integrated database retrieval system