KEGG   Leptothrix cholodnii: Lcho_2875Help
Entry
Lcho_2875         CDS       T00681                                 

Definition
(GenBank) pseudouridine synthase, RluA family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
lch  Leptothrix cholodnii
Brite
KEGG Orthology (KO) [BR:lch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lch03009]
    Lcho_2875
Enzymes [BR:lch01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Lcho_2875
Ribosome biogenesis [BR:lch03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Lcho_2875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ACB35140
UniProt: B1XXM0
Position
complement(3165278..3166387)
Genome map
AA seq 369 aa AA seqDB search
MNGVSVVDESRPLGDDEVVADDDEVASADAATVEPLEVERRLAVVEAAAHGERLDKWLVR
IAPEFSRAHLQGLVEGGHVRCGEQVLRQSHKKVMAGQQIEVALWPTAQSTAFRAEAMTLA
VVHEDAHLLVIDKPAGLVVHPAAGHWSGTLLNGLLAHHAAAAHLPRAGIVHRLDKDTSGL
MLVAKSLQAHTALVRAIAARDVKREYLALVHGAVMDGLQVIDAPLGRDPVSRVRMAIVAS
GKPARTDVRRLAVAELPGDGVRQLPGATRAPRQVSAVHCQLHTGRTHQIRVHLASRGHPL
LADAMYGGAPAFGLQRQALHAARLHLLHPIDGRPLAFEAALPADLALAWRAVAGDPASAL
PPYGYNRGQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaacggggtttccgtggtcgacgaatcgaggccgctcggcgatgacgaggtcgtggcc
gacgacgacgaggtcgcatcggccgatgcggcgacggtcgagccgctggaagtcgagcgg
cgcctggcggtggtcgaggctgctgcgcatggcgaacggctcgacaagtggctggtgcgc
atcgcgcccgagttctctcgcgctcatctgcaggggctggtcgaggggggtcatgtgcgc
tgcggcgagcaggtgctgcggcagtcgcacaagaaggtgatggccggccagcagatcgaa
gtggcgctctggccgaccgcgcagagcacggcctttcgcgccgaggcgatgacgctggcg
gtggtccacgaggacgcgcacctgctggtcatcgacaagccggccggcctggtggtgcac
ccggcggcgggccactggagcggcaccctgctcaacggcctgctggcgcatcacgccgcg
gcggcccacctgccacgtgccggcatcgtgcatcggctcgacaaggacacctcgggcctg
atgctggtggccaagtcgctgcaggcgcacaccgcgctggtgcgggcgatcgcggcacgc
gacgtcaagcgcgagtacctggcgctcgtgcatggcgcggtgatggacggcctgcaggtg
atcgatgcgccgctcggccgcgatccggtgtcgcgcgtgcgcatggcgatcgttgccagc
ggcaagccagcgcgcaccgacgtgcggcgtcttgcggtggccgagctgcccggtgacggc
gttcgccagttgcccggcgccacccgcgcgccgcggcaggtgagcgccgttcactgccag
ctgcacaccgggcgcacgcatcagatccgggtgcatctggcttcgcgtggccaccccttg
ctggccgacgccatgtacggtggcgcgccggccttcggtctgcagcgacaggccttgcac
gcggcacggctgcatctgctgcatccgatcgatggtcggccgctggccttcgaagccgca
ctgccggccgatctggcgctggcctggcgcgcggttgcgggagatcccgcgagtgcattg
ccgccatatggctacaatcggggccaataa

DBGET integrated database retrieval system