KEGG   Leptothrix cholodnii: Lcho_4089
Entry
Lcho_4089         CDS       T00681                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
lch  Leptothrix cholodnii
Pathway
lch03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Lcho_4089
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lch02044]
    Lcho_4089
Secretion system [BR:lch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Lcho_4089
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACB36341
UniProt: B1XXM2
Position
complement(4584916..4585401)
AA seq 161 aa
MAVDMFIKIGDIKGESKDDAHKTEIDVLAWSWGLSQSGSAHMGGGAGAGKVSVQDISLTK
YVDSSSTALIVAACKGTHIKQATLTVRKAGDTPLEYIKITLDEVMVSSLSTGGSGGEDRL
TENVTLNFAKFKVEYTIQADTGGKGTTSTAAWDIPANKPVG
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctgtagacatgttcatcaagatcggcgacatcaagggcgagtcgaaagacgacgcg
cacaagaccgaaatcgacgtgctggcctggagctggggcctgagccagagcggctcggcg
cacatgggcggtggcgcgggtgcgggcaaggtcagcgtgcaggacatctcgctgaccaag
tacgtcgattcgtcgtccaccgcgctgatcgtggcggcctgcaagggcacccacatcaag
caggccacgctgaccgtgcgcaaggccggcgacacgccgctcgaatacatcaagatcacg
ctcgacgaggtgatggtgtcgtcgctgtcgaccggcggcagcggtggcgaggaccgcctg
accgagaacgtcacgctgaacttcgccaagttcaaggtcgaatacaccatccaggccgac
accggcggcaagggcaccaccagcacagcggcctgggacatcccggccaacaagccggtg
ggctga

DBGET integrated database retrieval system