KEGG   Leptothrix cholodnii: Lcho_4091
Entry
Lcho_4091         CDS       T00681                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
lch  Leptothrix cholodnii
Brite
KEGG Orthology (KO) [BR:lch00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lch02044]
    Lcho_4091
Secretion system [BR:lch02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Lcho_4091
SSDB
Motif
Pfam: T6SS_VipA Nucleocap_ssRNA
Other DBs
NCBI-ProteinID: ACB36343
UniProt: B1XXM4
Position
complement(4587063..4587569)
AA seq 168 aa
MATSSQKFIARNRAPRVQIEYDVETYGAEKKVQVPFVMGVLADLSGKPAEPLAPVADRKF
LEIDVDNFNSRMKSMKPRVAFQVANELTGEGNLAVDISFETLDDFSPAAVARKVEGLRQL
LEARQQLSNLITYMDGKTGAEELLAKVIKDQALLQSLTQAAKPAGTPE
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccaccagcagccagaaattcatcgcccgcaatcgcgccccgcgggtgcagatcgaa
tacgacgtcgagacctacggcgccgagaagaaggtgcaggtgccgttcgtgatgggcgtg
ctggccgacctgagcggcaagccggccgagccgctggcgccggtggcggatcgcaagttc
ctcgagatcgacgtcgacaacttcaactcgcgcatgaagtcgatgaagccgcgggtggcc
ttccaggtcgccaacgagctgaccggcgagggcaacctggcggtcgacatcagcttcgag
acgctcgacgacttctcgcccgcggcggtggcgcgcaaggtcgaggggctgcgccagctg
ctcgaggcgcgccagcagctgtcgaacctgatcacctacatggacggcaagaccggcgcc
gaggagctgctggccaaggtcatcaaggaccaggcgctgctgcagtcgctgacccaggcg
gccaagccggccggcacccccgaatga

DBGET integrated database retrieval system