KEGG   Leptothrix cholodnii: Lcho_4166Help
Entry
Lcho_4166         CDS       T00681                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
lch  Leptothrix cholodnii
Pathway
lch00620  Pyruvate metabolism
lch00630  Glyoxylate and dicarboxylate metabolism
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01200  Carbon metabolism
Module
lch_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lcho_4166
   00630 Glyoxylate and dicarboxylate metabolism
    Lcho_4166
Enzymes [BR:lch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Lcho_4166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase PmrD
Motif
Other DBs
NCBI-ProteinID: ACB36417
UniProt: B1XYI1
Position
4666887..4669091
Genome map
AA seq 734 aa AA seqDB search
MNSRTPIHGLQVATELFRFIEGEVLPGTGVSSSEFWAGFDHIVADLAPKNAALLAERDRI
QSAMDAWHSANPGPITDMPAYRAHLEQIGYLVPVPANVQVTTANVDAELALQAGPQLVVP
IMNARYALNAANARWGSLYDALYGTDAISEADGAERAGGYNPVRGAKVIAYARQVLDNAA
PLVNASHVNATGYAIEAGQLVVSMAGGVLTGLADPAQLVGYTGDAAAPKSVLLVHNGLHL
DIQIDRSTTIGKSDAAGISDVVVESALSTILDLEDSIAAVDAEDKVLAYRNWLGIQLGTL
TEEVAKGGKTFTRRLNADRIYTAPDGSGEVKLHGRSLMFLRNVGHLMTNPAVLWGPEGRE
IPEGILDAVVTTTIALHDLKRHGINGLSNSRTGSIYIVKPKMHGPAEVAFAAELFSRVEL
LLGLPDSTVKLGIMDEERRTSVNLKACIAAASSRVAFINTGFLDRTGDEMHTAMLAGPMM
RKGDIKGSAWIAAYERRNVLIGLSCGLRGRAQIGKGMWAMPDLMAAMLEQKIGHPKAGAN
TAWVPSPTAATLHALHYHQVSVAAVQQQIEQSGEAADPAISETLLTNLLTIPVVAEAKWS
ATERQQEIDNNAQGILGYVVRWVDQGVGCSKVPDINGVGLMEDRATLRISSQHIANWLHH
GVVTEAQVRETFARMAAVVDGQNAGDPLYKAMAGNPDCAAYQAALDLVFKGKEQPSGYTE
PLLHAWRLKVKAAA
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgaactcacgcacccccatccacggcctgcaagtggccaccgagctgttccgtttcatc
gaaggcgaagtgctgcccggcaccggcgtgtcgagttcggagttctgggccggcttcgac
cacatcgtcgccgacctggcgcccaagaacgccgcgctgctggccgagcgtgaccgcatc
cagagcgcgatggacgcctggcacagcgccaaccccggcccgatcaccgacatgccggcg
tatcgcgcgcatctggagcagatcggctacctggtgccggtgcccgccaacgtgcaggtc
accaccgccaacgtcgacgccgaactggcgctgcaggccggcccgcagctggtggtgccg
atcatgaacgcgcgctacgcgctcaacgccgccaacgcgcgctggggcagcctgtacgac
gcgctgtacggcaccgacgcgatctccgaggccgacggcgccgagcgcgccggcggctac
aacccggtgcgcggcgccaaggtcatcgcctacgcgcgtcaggtgctcgacaacgccgcg
ccgctggtcaacgccagccacgtcaatgccaccggctacgccatcgaggccggccagctg
gtcgtcagcatggccggtggcgtgctcaccggcctggccgatccggcccagctggtcggc
tacaccggcgacgccgccgcgccgaagtcggtgctgctggtgcacaacggcctgcacctg
gacatccagatcgaccgcagcacgaccatcggcaagagcgacgccgccggcatcagcgat
gtcgtcgtcgaatcggcgctgtcgaccatcctcgacctcgaagactcgatcgccgcggtc
gatgccgaggacaaggtgctggcctaccgcaactggctcggcatccagctcggcacgctg
accgaagaggtcgccaagggtggcaagaccttcacgcgccgcctcaacgccgaccgcatc
tacaccgcgcccgacggctcgggcgaggtcaagctgcacggccgctcgctgatgttcctg
cgcaatgtcggccatctgatgacgaacccggcggtgctgtggggccccgagggccgcgag
attccggaaggcatcctcgacgccgtggtcaccaccacgatcgcgctgcacgacctgaag
cgccacggcatcaacggcctgagcaacagccgcaccggcagcatctacatcgtcaagccc
aagatgcacggcccagccgaagtggcctttgccgccgagctgttcagccgcgtcgagctg
ctgctgggcctgcccgacagcaccgtcaagctcggcatcatggacgaggagcgccgcacc
agcgtcaacctgaaggcctgcatcgccgccgcttcgagccgcgtcgccttcatcaacacc
ggcttcctcgaccgcaccggcgacgagatgcacaccgccatgctggccggcccgatgatg
cgcaagggcgacatcaagggcagcgcctggatcgccgcctacgagcgccgcaacgtgctg
atcggcctctcctgcggcctgcgtggccgcgcgcagatcggcaagggcatgtgggccatg
cccgacctgatggccgcgatgctggagcagaagatcggccaccccaaggccggtgccaac
accgcctgggtgccgagcccgaccgccgcgacgctgcacgcgctgcactaccaccaggtc
agcgtggccgcggtgcagcagcagatcgagcagtccggcgaagcggccgacccggccatc
agcgagacgctgctgaccaacctgctgacgattccggtcgtcgccgaagccaagtggagc
gccaccgagcgccagcaggagatcgacaacaacgcccagggcatcctgggttacgtggtg
cgctgggtcgaccagggcgtgggctgctccaaggtgcccgacatcaacggcgtcggcctg
atggaagaccgcgccaccctgcgcatcagcagccagcacatcgccaactggctgcaccac
ggcgtggtgaccgaagcgcaggtgcgcgagacctttgcccgcatggccgcggtggtggac
ggccagaacgccggcgacccgctctacaaggccatggccggcaacccggactgcgcggcc
tatcaggcggcgctggacctggtgttcaagggcaaggagcagccgagtgggtacaccgag
ccgctgctgcatgcgtggcggttgaaggtgaaggcggcggcttga

DBGET integrated database retrieval system