KEGG   Leuconostoc citreum: LCK_00755Help
Entry
LCK_00755         CDS       T00663                                 

Definition
(GenBank) Threonine dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lci  Leuconostoc citreum
Pathway
lci00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LCK_00755
Enzymes [BR:lci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LCK_00755
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LCK_00755
    1.1.1.-  
     LCK_00755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C Pyr_redox_2 TrkA_N Pyr_redox_3 2-Hacid_dh_C Pyr_redox UDPG_MGDP_dh_N Shikimate_DH ThiF 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACA82587
UniProt: B1MYI5
Position
798467..799516
Genome map
AA seq 349 aa AA seqDB search
MKAAVWHGVKDVRVEDVELKPMKSNEVVVRVAYAGICGSDLHEYLEGPVFIPVDKQDELT
GGQAPLTMGHEFSGVIDKVGADVTNFKVGDHVSINPTVTKGNWADDVDVYDGYSFIGLST
DGGFTSFVNVPEENLYHLPEDFSLKLAATIEPTAVAVQAVKEGGLRFGQKVVIFGAGPIG
VLVAAAAKAAGATKIVVVDLSEVRLNKALEMGATDVINPSQVKDAIGAIKAIIPEGADVS
FEVAGVQPTFEQAIDATRPRGTMVIVSIFARPISFNPMQLMNAGVKLTTTIAYSKETFQQ
TVDLVSSGQIDVEPVITDTIVLDNIVEAGFESLTHDKSQAKILVDLSQE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggcatggtgttaaagacgttcgtgttgaggacgttgagctaaaa
cccatgaagtcaaatgaagtcgttgttcgtgttgcttacgccggcatttgcggtagtgat
ttacatgaataccttgaaggaccagtgttcattccagttgataaacaagatgagttgact
ggtggacaagcaccattgacaatgggccatgaattttcaggcgttattgacaaagttggt
gccgatgtgactaacttcaaagtcggagatcatgtatctattaatccaacagttacaaag
ggtaactgggcagatgatgtcgatgtttatgatggttatagttttattggcttaagtaca
gatggtggttttacgtcatttgtcaatgtgcctgaagagaatttgtatcatttacccgaa
gacttctcattgaagctggctgcaacaatcgaaccaactgctgtggctgttcaagccgtt
aaagagggtggtttgcgctttggtcaaaaagttgttatttttggtgctgggcctattggt
gtgttggtagcggctgcagcaaaagctgccggtgcaactaaaattgtcgttgtcgattta
tctgaggtgcgtttgaataaagcacttgagatgggtgcaacagatgtgattaaccctagt
caagttaaagacgccatcggtgctattaaggcgattattcctgaaggagcagatgtttcc
tttgaagttgctggtgtacaacctacgtttgaacaggcaattgatgctacgcgaccacgt
ggaaccatggtaattgtatctatttttgctcggccaattagttttaatccaatgcaatta
atgaatgcaggggttaaactgacaacaacgattgcctattcaaaagaaaccttccaacaa
actgttgaccttgtaagtagtggccaaatcgatgttgagcctgttattacagatacgatt
gtattagataatattgtagaagcaggatttgaatcgttaacacatgacaagtctcaagca
aagattttggttgatcttagccaagaataa

DBGET integrated database retrieval system