KEGG   Leuconostoc citreum: LCK_01226
Entry
LCK_01226         CDS       T00663                                 

Symbol
mscL2
Name
(GenBank) Large conductance mechanosensitive channel protein
  KO
K03282  large conductance mechanosensitive channel
Organism
lci  Leuconostoc citreum
Brite
KEGG Orthology (KO) [BR:lci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lci02000]
    LCK_01226 (mscL2)
Transporters [BR:lci02000]
 Other transporters
  Pores ion channels [TC:1]
   LCK_01226 (mscL2)
SSDB
Motif
Pfam: MscL DUF373 Baculo_gp64
Other DBs
NCBI-ProteinID: ACA83051
UniProt: B1MZU9
Position
1281294..1281674
AA seq 126 aa
MLSEFKTFIMRGNVLDLAVGVIIGGAFTGIVKSLTNNLISPIITFFTGGTSDLQNLKLVV
TKELTFKYGAFLNDVINFLITAFVVFLLVKFVNRILRTNKKEEVKANPELEVLAEIRDLL
EAQKKA
NT seq 381 nt   +upstreamnt  +downstreamnt
atgttatcagaattcaagacatttatcatgcgcggcaacgtgcttgatttagccgttggt
gtcattatcggtggtgctttcactggtattgtcaagtcattaaccaataacttaatcagt
cctattatcacatttttcaccggtggcacctcagatcttcaaaacttaaaattagtcgtt
actaaggaattaacattcaaatatggtgcttttttgaatgacgtcattaacttcttaatt
actgcctttgtcgtctttctcttggtaaaatttgttaatcgtatcctgcgtacaaacaaa
aaagaagaagttaaagccaatccagaattagaagtattagctgaaatccgtgacttgctt
gaagcacagaaaaaagcttaa

DBGET integrated database retrieval system