KEGG   Leuconostoc citreum: LCK_01703Help
Entry
LCK_01703         CDS       T00663                                 

Gene name
fadA
Definition
(GenBank) Acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lci  Leuconostoc citreum
Pathway
lci00071  Fatty acid degradation
lci00072  Synthesis and degradation of ketone bodies
lci00280  Valine, leucine and isoleucine degradation
lci00310  Lysine degradation
lci00362  Benzoate degradation
lci00620  Pyruvate metabolism
lci00630  Glyoxylate and dicarboxylate metabolism
lci00640  Propanoate metabolism
lci00650  Butanoate metabolism
lci00900  Terpenoid backbone biosynthesis
lci01100  Metabolic pathways
lci01110  Biosynthesis of secondary metabolites
lci01120  Microbial metabolism in diverse environments
lci01130  Biosynthesis of antibiotics
lci01200  Carbon metabolism
lci01212  Fatty acid metabolism
lci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCK_01703 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    LCK_01703 (fadA)
   00640 Propanoate metabolism
    LCK_01703 (fadA)
   00650 Butanoate metabolism
    LCK_01703 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LCK_01703 (fadA)
   00072 Synthesis and degradation of ketone bodies
    LCK_01703 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LCK_01703 (fadA)
   00310 Lysine degradation
    LCK_01703 (fadA)
   00380 Tryptophan metabolism
    LCK_01703 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCK_01703 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LCK_01703 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LCK_01703 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lci04147]
    LCK_01703 (fadA)
Enzymes [BR:lci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LCK_01703 (fadA)
Exosome [BR:lci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCK_01703 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACA83525
UniProt: B1MWR6
Position
complement(1786800..1787951)
Genome map
AA seq 383 aa AA seqDB search
MNNLTTPVGILSAKRLPIGKINGLYTEQSPETLVANLLQQQVAMISTHRLKQVDQVILGN
VTNQGGNIARRAALAAGIDSSTPAYTIDAQCASGLVAIASGAQAILNQDAKLVVAGGVES
TSRSYVTIDRETNEPLKRFPMVPEGQLDLDMGIVAENMSSRYNISREQQDNYAFNSHQKA
KKAFENKQINAEIVPFSQASVNITQDQCPRFDTSLSKLHQLKPAFRSGGTVTAGNSCPIN
DGAATVLMTGSQTGEAMAGYYLGHTTVGIAPEKFILGPIAATQKLLDKYALTMSDIAVVE
LNEAFAVQSILCQAALKITDEQLNPLGGALAYGHPYGATGGIMIARLLNSLNRITQPALG
IATLCVAGGMGMSMLIGNQHWQV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaataacttgacaacaccagtaggcatattaagcgcaaaacgtctcccaattggtaaa
atcaatggcttatacacagagcagtcgcctgagacacttgttgctaatttgttacaacag
caggtagccatgatatcaacacatcgtttaaagcaggttgatcaagtcattttaggcaat
gtcacgaatcaagggggaaatattgcgcgtcgtgcagctttagccgctgggatagattcg
agcacaccagcttatactatagatgcgcaatgtgcttctggtttggtggctattgcttcc
ggcgcccaagccatcttgaatcaggatgccaaattagtcgttgcgggtggcgtcgaaagt
acttcccgtagttatgtgacaattgatcgagaaacaaatgagccactcaaacgctttccg
atggtaccagaagggcaactggacttagacatgggtattgtggcggaaaatatgagctca
cgttataacatttcacgcgagcaacaggataattacgcgttcaacagccatcaaaaagca
aaaaaagcttttgaaaataagcaaatcaatgctgaaattgttccttttagtcaggcgtca
gtcaatatcacacaagaccagtgtccgagatttgatacctcgcttagtaaattacaccaa
ttgaagccagcgtttcgttctggtggtacggtgactgcgggcaatagttgtccgattaat
gatggtgcggcaacggtgctgatgacgggaagtcaaacaggggaagcaatggcggggtat
tatttagggcatacgaccgtaggcattgcgcctgaaaaattcattctgggtcctattgct
gccacacaaaagttattagacaaatatgcactaactatgtctgacattgcagttgtggag
cttaatgaggcttttgccgtgcaaagtattttatgccaagcggcgttaaaaattaccgat
gaacaattaaatccattaggtggcgcgttagcttatggtcatccctatggtgctacgggt
ggcattatgattgcgcgattattgaatagtttaaatcgcatcacacaaccggcgttgggt
attgccacgctatgtgttgccggtggtatggggatgagcatgctgataggaaatcaacac
tggcaagtttaa

DBGET integrated database retrieval system