KEGG   Lactobacillus casei LOCK919: LOCK919_0526Help
Entry
LOCK919_0526      CDS       T02729                                 

Definition
(GenBank) Fructose-bisphosphate aldolase class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl00010  Glycolysis / Gluconeogenesis
lcl00030  Pentose phosphate pathway
lcl00051  Fructose and mannose metabolism
lcl00680  Methane metabolism
lcl01100  Metabolic pathways
lcl01110  Biosynthesis of secondary metabolites
lcl01120  Microbial metabolism in diverse environments
lcl01130  Biosynthesis of antibiotics
lcl01200  Carbon metabolism
lcl01230  Biosynthesis of amino acids
Module
lcl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
lcl_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:lcl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LOCK919_0526
   00030 Pentose phosphate pathway
    LOCK919_0526
   00051 Fructose and mannose metabolism
    LOCK919_0526
  09102 Energy metabolism
   00680 Methane metabolism
    LOCK919_0526
Enzymes [BR:lcl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     LOCK919_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase TMP-TENI ThiG QRPTase_C AP_endonuc_2 BKACE CutC
Motif
Other DBs
NCBI-ProteinID: AGP67277
UniProt: K6PZ93
Position
complement(535382..536263)
Genome map
AA seq 293 aa AA seqDB search
MPLVNAAELVKAAHKGHYCIGAFNTNNLEWTRAILAGAQELNVPVIIQTSMGAAKYMGGY
EFCQTMIEATVKAMGITVPVVIHLDHGNYEAAKEAIAAGYNSVMFDGHDLDFEDNLEKTK
EIVKLAHAKGISVEAEVGSIGGEEDGVVGEGELADVEEAKTLAATGIDFLAAGIGNIHGQ
YPDNWKGLHFDRLQELNDAVKMPLVLHGGSGIPQEQVQKAITMGISKLNINTECQLAFAK
ATREYIEAGKDQQGKGFDPRKLLKPGTDAITDTFKEITGWIGNKPVKMVPEAL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgccattagttaacgctgcagagcttgtaaaagctgcacataaaggtcactactgtatc
ggtgccttcaacaccaataacttggaatggacacgcgccatccttgccggtgcgcaagaa
ttgaacgttccggttatcatccagacatccatgggtgctgctaagtacatgggcggctat
gaattctgccagaccatgatcgaagcaacggttaaagccatgggcatcaccgttcctgtt
gtgattcatttggatcacggtaactacgaagctgccaaggaagctattgctgccggctac
aactccgttatgttcgacggccacgacctcgactttgaagataacttggaaaaaaccaag
gaaatcgttaagttggctcacgccaagggcatttctgttgaagccgaagttggttctatc
ggcggtgaagaagacggtgttgtcggcgaaggcgaattagctgacgttgaagaagccaag
acattagccgctaccgggatcgacttcctggctgctggtatcggcaacatccacggtcaa
tatccagacaactggaagggcctgcacttcgatcgtctgcaagaattgaacgatgctgtt
aagatgccgctcgttcttcacggcggttctggtatccctcaagaacaagttcaaaaggca
atcaccatgggtatttccaagttgaacatcaacaccgaatgccagcttgcctttgctaag
gcaacccgtgaatacatcgaagctggtaaggatcagcaaggcaagggcttcgaccctcgt
aagctgctcaagccaggcaccgatgctatcaccgataccttcaaagaaatcaccggctgg
attggcaacaaaccagttaagatggttccagaagcactttaa

DBGET integrated database retrieval system