KEGG   Lactobacillus casei LOCK919: LOCK919_1057Help
Entry
LOCK919_1057      CDS       T02729                                 

Definition
(GenBank) Ribosomal RNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
lcl  Lactobacillus casei LOCK919
Brite
KEGG Orthology (KO) [BR:lcl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lcl03009]
    LOCK919_1057
Enzymes [BR:lcl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     LOCK919_1057
Ribosome biogenesis [BR:lcl03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LOCK919_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 MTS MetW Ubie_methyltran FmrO PrmA TPMT Methyltransf_18 PCMT
Motif
Other DBs
NCBI-ProteinID: AGP67760
UniProt: S4ZME2
Position
1029604..1030446
Genome map
AA seq 280 aa AA seqDB search
MRKRETKIHLAAAQAPLFAGPVCGQPLQVTAGSLVCVNGHVRDFSHKGTLNFLNQQVATE
YTTPMLAARRRMLNAGLFTPFLAAMAAKLPKHQRLLDVGCGEGTPTAYLAEAGQQTAVGF
DISSPAINLAGGLAAPVLFAVADLAHLPFVNDAFDTVTDIFSPGNYREFRRVLRPDGQLL
KIIPRAGYLREIREGLYSGTAKAVYNNEPVLKRFLAAFPDASQETITYDFPLAPTQFGDL
MAMTPLTWQAPADQRDQMLAAPPISIHIDVDLLTVSHLVK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagcgtgaaacaaaaattcatttggccgcagcacaagcaccgctttttgctggt
ccagtctgtggccaaccattacaggtgacagcgggatcgttggtttgtgtcaacggacat
gtacgcgatttcagccacaaagggacgctgaacttcctgaatcagcaagtagccaccgaa
tacacgacgccgatgttagccgcacggcggcgaatgttgaacgctggtttgttcacccca
tttttggcagctatggcagccaaacttccgaaacatcaacgactgttagatgtcggctgc
ggggaaggcacgccgactgcgtatttggccgaggcgggtcaacaaactgccgtgggtttt
gatatctcatcaccggcgatcaatctagcaggcggcttagcggcaccagttctgtttgcg
gttgcggatctggcccacctgcctttcgttaacgatgcatttgataccgtgaccgacatc
ttttcgccaggtaattatcgtgaattcagacgtgtgctgcgtcctgatggtcagctattg
aaaattattccgcgggcgggttatcttcgagaaatccgggaaggcttatactccgggacg
gctaaggctgtatataacaatgagcctgtcttaaaaaggttcttagcagctttccctgat
gcgagtcaggagacaatcacctacgattttccgttagcgccaactcaatttggtgattta
atggccatgaccccgttaacgtggcaggcgcccgccgatcaacgcgaccaaatgcttgct
gcaccgccgattagtatccatattgatgttgatttgctcactgtgtcgcatcttgtcaag
taa

DBGET integrated database retrieval system